SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0013
         (573 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D14530-1|BAA03400.1|  143|Homo sapiens yeast ribosomal protein S...   103   3e-22
CR456996-1|CAG33277.1|  143|Homo sapiens RPS23 protein.               103   3e-22
BC070221-1|AAH70221.1|  143|Homo sapiens ribosomal protein S23 p...   103   3e-22
AB007158-1|BAA25822.1|   59|Homo sapiens ribosomal protein S23 p...   102   1e-21
Y11681-2|CAA72377.1|  138|Homo sapiens mitochondrial ribosomal p...    35   0.23 
CR407609-1|CAG28537.1|  138|Homo sapiens MRPS12 protein.               35   0.23 
BC007499-1|AAH07499.1|  138|Homo sapiens mitochondrial ribosomal...    35   0.23 
BC006424-1|AAH06424.1|  138|Homo sapiens mitochondrial ribosomal...    35   0.23 
BC001617-1|AAH01617.1|  138|Homo sapiens mitochondrial ribosomal...    35   0.23 
AF058761-1|AAC64704.1|  138|Homo sapiens ribosomal protein S12 p...    35   0.23 

>D14530-1|BAA03400.1|  143|Homo sapiens yeast ribosomal protein S28
           homologue protein.
          Length = 143

 Score =  103 bits (248), Expect = 3e-22
 Identities = 50/52 (96%), Positives = 50/52 (96%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N IEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYK KKERPRS
Sbjct: 92  NFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS 143



 Score = 82.6 bits (195), Expect = 9e-16
 Identities = 38/42 (90%), Positives = 39/42 (92%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGC
Sbjct: 49  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGC 90


>CR456996-1|CAG33277.1|  143|Homo sapiens RPS23 protein.
          Length = 143

 Score =  103 bits (248), Expect = 3e-22
 Identities = 50/52 (96%), Positives = 50/52 (96%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N IEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYK KKERPRS
Sbjct: 92  NFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS 143



 Score = 82.6 bits (195), Expect = 9e-16
 Identities = 38/42 (90%), Positives = 39/42 (92%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGC
Sbjct: 49  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGC 90


>BC070221-1|AAH70221.1|  143|Homo sapiens ribosomal protein S23
           protein.
          Length = 143

 Score =  103 bits (248), Expect = 3e-22
 Identities = 50/52 (96%), Positives = 50/52 (96%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N IEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYK KKERPRS
Sbjct: 92  NFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS 143



 Score = 82.6 bits (195), Expect = 9e-16
 Identities = 38/42 (90%), Positives = 39/42 (92%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGC
Sbjct: 49  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGC 90


>AB007158-1|BAA25822.1|   59|Homo sapiens ribosomal protein S23
           protein.
          Length = 59

 Score =  102 bits (244), Expect = 1e-21
 Identities = 49/51 (96%), Positives = 49/51 (96%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPR 101
           N IEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYK KKERPR
Sbjct: 9   NFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPR 59


>Y11681-2|CAA72377.1|  138|Homo sapiens mitochondrial ribosomal
           protein S12 precursor protein.
          Length = 138

 Score = 34.7 bits (76), Expect = 0.23
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           K+PNSA RKC RV+L   G++   F+P +G
Sbjct: 71  KKPNSANRKCCRVRL-STGREAVCFIPGEG 99


>CR407609-1|CAG28537.1|  138|Homo sapiens MRPS12 protein.
          Length = 138

 Score = 34.7 bits (76), Expect = 0.23
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           K+PNSA RKC RV+L   G++   F+P +G
Sbjct: 71  KKPNSANRKCCRVRL-STGREAVCFIPGEG 99


>BC007499-1|AAH07499.1|  138|Homo sapiens mitochondrial ribosomal
           protein S12 protein.
          Length = 138

 Score = 34.7 bits (76), Expect = 0.23
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           K+PNSA RKC RV+L   G++   F+P +G
Sbjct: 71  KKPNSANRKCCRVRL-STGREAVCFIPGEG 99


>BC006424-1|AAH06424.1|  138|Homo sapiens mitochondrial ribosomal
           protein S12 protein.
          Length = 138

 Score = 34.7 bits (76), Expect = 0.23
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           K+PNSA RKC RV+L   G++   F+P +G
Sbjct: 71  KKPNSANRKCCRVRL-STGREAVCFIPGEG 99


>BC001617-1|AAH01617.1|  138|Homo sapiens mitochondrial ribosomal
           protein S12 protein.
          Length = 138

 Score = 34.7 bits (76), Expect = 0.23
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           K+PNSA RKC RV+L   G++   F+P +G
Sbjct: 71  KKPNSANRKCCRVRL-STGREAVCFIPGEG 99


>AF058761-1|AAC64704.1|  138|Homo sapiens ribosomal protein S12
           protein.
          Length = 138

 Score = 34.7 bits (76), Expect = 0.23
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           K+PNSA RKC RV+L   G++   F+P +G
Sbjct: 71  KKPNSANRKCCRVRL-STGREAVCFIPGEG 99


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,529,608
Number of Sequences: 237096
Number of extensions: 2126800
Number of successful extensions: 6141
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 6007
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6141
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5872755824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).