SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0012
         (588 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT007451-1|AAP36119.1|  623|Homo sapiens ATP-binding cassette, s...   108   2e-23
BC001661-1|AAH01661.1|  623|Homo sapiens ATP-binding cassette, s...   108   2e-23
AJ005016-1|CAA06290.1|  550|Homo sapiens ABC transporter protein.     108   2e-23
AF261092-1|AAG13903.1|  623|Homo sapiens iron inhibited ABC tran...   108   2e-23
AF261091-1|AAG13902.1|  623|Homo sapiens iron inhibited ABC tran...   108   2e-23
AC021097-3|AAS00379.1|  623|Homo sapiens unknown protein.             108   2e-23
AC021097-2|AAS00378.1|  634|Homo sapiens unknown protein.             108   2e-23
BC051884-1|AAH51884.2|  709|Homo sapiens ATP-binding cassette, s...    62   2e-09
BC051754-1|AAH51754.1|  709|Homo sapiens ATP-binding cassette, s...    62   2e-09
BC009253-1|AAH09253.1|  709|Homo sapiens ATP-binding cassette, s...    62   2e-09
AK002060-1|BAA92063.1|  709|Homo sapiens protein ( Homo sapiens ...    62   2e-09
BX248518-8|CAM26017.1|  845|Homo sapiens ATP-binding cassette su...    60   8e-09
BX248518-6|CAM26016.1|  807|Homo sapiens ATP-binding cassette su...    60   8e-09
BX119957-4|CAM25907.1|  845|Homo sapiens ATP-binding cassette su...    60   8e-09
BX119957-2|CAM25906.1|  807|Homo sapiens ATP-binding cassette su...    60   8e-09
BX000357-8|CAI18562.1|  807|Homo sapiens ATP-binding cassette, s...    60   8e-09
BX000357-6|CAI18563.1|  845|Homo sapiens ATP-binding cassette, s...    60   8e-09
BC112923-1|AAI12924.1|  845|Homo sapiens ATP-binding cassette, s...    60   8e-09
BC034488-1|AAH34488.1|  845|Homo sapiens ATP-binding cassette, s...    60   8e-09
BA000025-75|BAB63325.1|  807|Homo sapiens TNFalpha-inducible ATP...    60   8e-09
AL662825-7|CAI17837.1|  845|Homo sapiens ATP-binding cassette, s...    60   8e-09
AL662825-6|CAI17836.1|  807|Homo sapiens ATP-binding cassette, s...    60   8e-09
AL662800-8|CAI18158.1|  845|Homo sapiens ATP-binding cassette, s...    60   8e-09
AL662800-7|CAI18159.1|  807|Homo sapiens ATP-binding cassette, s...    60   8e-09
AF027302-1|AAC70891.1|  807|Homo sapiens TNF-alpha stimulated AB...    60   8e-09
AB209564-1|BAD92801.1|  593|Homo sapiens ATP-binding cassette, s...    60   8e-09
AB202093-1|BAE78612.1|  807|Homo sapiens ATP-binding cassette, s...    60   8e-09
AB103602-1|BAF31263.1|  807|Homo sapiens ABC50 protein protein.        60   8e-09
AB088096-1|BAC54928.1|  807|Homo sapiens ATP-binding cassette, s...    60   8e-09
AK092415-1|BAC03881.1|  703|Homo sapiens protein ( Homo sapiens ...    58   2e-08
BX248518-5|CAM26015.1|  340|Homo sapiens ATP-binding cassette su...    42   0.002
BX119957-1|CAM25905.1|  340|Homo sapiens ATP-binding cassette su...    42   0.002
BX000357-5|CAI18561.2|  340|Homo sapiens ATP-binding cassette, s...    42   0.002
AL662825-5|CAI17835.2|  340|Homo sapiens ATP-binding cassette, s...    42   0.002
AL662800-5|CAI18156.2|  340|Homo sapiens ATP-binding cassette, s...    42   0.002
AL359813-2|CAI23217.1| 1492|Homo sapiens ATP-binding cassette, s...    40   0.009
AK000002-1|BAA92227.1| 1513|Homo sapiens FLJ00002 protein protein.     40   0.009
AY032599-1|AAK39642.1| 1463|Homo sapiens multidrug resistance-as...    38   0.020
U83659-1|AAB71756.1|  485|Homo sapiens multidrug resistance-asso...    35   0.25 
Y17151-1|CAA76658.2| 1527|Homo sapiens multidrug resistance prot...    34   0.32 
M55131-1|AAC13657.1| 1480|Homo sapiens cystic fibrosis transmemb...    34   0.32 
M28668-1|AAA35680.1| 1480|Homo sapiens protein ( Human cystic fi...    34   0.32 
DQ388145-1|ABD72217.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388143-1|ABD72213.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388142-1|ABD72211.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388141-1|ABD72209.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388140-1|ABD72207.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388139-1|ABD72205.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388138-1|ABD72203.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388137-1|ABD72201.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388136-1|ABD72199.1| 1321|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388135-1|ABD72197.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388134-1|ABD72195.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388133-1|ABD72193.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388132-1|ABD72191.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388131-1|ABD72189.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388130-1|ABD72187.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388129-1|ABD72185.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ388128-1|ABD72183.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ356264-1|ABC87067.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ356263-1|ABC87065.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ356262-1|ABC87063.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ356261-1|ABC87061.1| 1462|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ356260-1|ABC87059.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ356259-1|ABC87057.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ356258-1|ABC87055.1| 1462|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ356257-1|ABC87053.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ354391-1|ABC79056.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ354390-1|ABC79054.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ354389-1|ABC79052.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
DQ354388-1|ABC79050.1| 1480|Homo sapiens cystic fibrosis transme...    34   0.32 
AY848832-1|AAW33659.1|  418|Homo sapiens cystic fibrosis transme...    34   0.32 
AY848831-1|AAW33658.1|  405|Homo sapiens cystic fibrosis transme...    34   0.32 
AY848829-1|AAW33656.1|  258|Homo sapiens cystic fibrosis transme...    34   0.32 
AJ294545-1|CAC69553.1| 1514|Homo sapiens multidrug resistance as...    34   0.32 
AF154001-1|AAD38185.1|  285|Homo sapiens MRP3s1 protein protein.       34   0.32 
AF104943-1|AAD04170.1| 1527|Homo sapiens ABC transporter MOAT-D ...    34   0.32 
AF085690-1|AAD02845.1| 1527|Homo sapiens multidrug resistance-as...    34   0.32 
AF083552-1|AAC34668.1| 1527|Homo sapiens canalicular multispecif...    34   0.32 
AF009670-1|AAD01430.1| 1528|Homo sapiens MRP3 protein.                 34   0.32 
AC000061-1|AAB46340.2|  484|Homo sapiens unknown protein.              34   0.32 
AB208954-1|BAD92191.1| 1533|Homo sapiens ATP-binding cassette, s...    34   0.32 
AB010887-1|BAA28146.1| 1527|Homo sapiens multidrug resistance-as...    34   0.32 
X06181-1|CAA29547.1|  431|Homo sapiens P-glycoprotein (431 AA) p...    33   0.75 
M29447-1|AAA59576.1| 1280|Homo sapiens P glycoprotein protein.         33   0.75 
M23234-1|AAA36207.1| 1279|Homo sapiens protein ( Human membrane ...    33   0.75 
M14758-1|AAA59575.1| 1280|Homo sapiens PGY1 protein.                   33   0.75 
EF034088-1|ABJ53424.1| 1286|Homo sapiens ATP-binding cassette, s...    33   0.75 
BC130424-1|AAI30425.1| 1280|Homo sapiens ATP-binding cassette, s...    33   0.75 
BC042531-1|AAH42531.1| 1286|Homo sapiens ATP-binding cassette, s...    33   0.75 
AY910577-1|AAW82430.1| 1280|Homo sapiens ATP-binding cassette, s...    33   0.75 
AF016535-1|AAB69423.1| 1279|Homo sapiens P-glycoprotein protein.       33   0.75 
AB208970-1|BAD92207.1| 1062|Homo sapiens Multidrug resistance pr...    33   0.75 
X83467-1|CAA58470.1|  660|Homo sapiens 70kD peroxisomal integral...    32   1.7  
X58528-1|CAA41416.1|  659|Homo sapiens 70kDa peroxisomal membran...    32   1.7  
M81182-1|AAA60128.1|  659|Homo sapiens 70kDa peroxisomal membran...    32   1.7  
BC068509-1|AAH68509.1|  549|Homo sapiens ABCD3 protein protein.        32   1.7  
BC021700-1|AAH21700.2|  395|Homo sapiens RYK protein protein.          32   1.7  
AL138758-1|CAC15960.2|  659|Homo sapiens ATP-binding cassette, s...    32   1.7  
BC063829-1|AAH63829.1| 1664|Homo sapiens peroxisome proliferator...    31   2.3  
BC063806-1|AAH63806.1| 1542|Homo sapiens PPRC1 protein protein.        31   2.3  
BC002561-1|AAH02561.2|  659|Homo sapiens PPRC1 protein protein.        31   2.3  
AL500527-6|CAH72219.1|  631|Homo sapiens peroxisome proliferator...    31   2.3  
AL500527-5|CAH72218.1| 1664|Homo sapiens peroxisome proliferator...    31   2.3  
AF325193-1|AAK11573.1| 1664|Homo sapiens PGC-1 related co-activa...    31   2.3  
AB011167-1|BAA25521.2| 1666|Homo sapiens KIAA0595 protein protein.     31   2.3  
X96588-1|CAA65406.1|  577|Homo sapiens receptor tyrosine kinase ...    31   3.0  
X95715-1|CAA65019.1|  453|Homo sapiens anthracycline resistance ...    31   3.0  
S59184-1|AAB26341.1|  606|Homo sapiens RYK protein.                    31   3.0  
BC131732-1|AAI31733.1| 1503|Homo sapiens ATP-binding cassette, s...    31   3.0  
AF381579-1|AAK59338.1|  142|Homo sapiens immunoglobulin heavy ch...    31   3.0  
AF076622-1|AAC79696.1| 1503|Homo sapiens MRP6 protein.                 31   3.0  
AB353947-1|BAF75364.1| 1257|Homo sapiens ATP-binding cassette, s...    31   3.0  
BC043423-1|AAH43423.1|  301|Homo sapiens ABCB6 protein protein.        31   4.0  
BC000559-1|AAH00559.1|  842|Homo sapiens ATP-binding cassette, s...    31   4.0  
AY207008-1|AAO37649.1| 1325|Homo sapiens ATP-binding cassette tr...    31   4.0  
AY081219-1|AAL88745.1| 1325|Homo sapiens multidrug resistance-as...    31   4.0  
AL356257-1|CAI16722.1| 1325|Homo sapiens ATP-binding cassette, s...    31   4.0  
AL157818-1|CAC36037.2| 1325|Homo sapiens ATP-binding cassette, s...    31   4.0  
AL139381-1|CAI16589.1| 1325|Homo sapiens ATP-binding cassette, s...    31   4.0  
AK057026-1|BAB71347.1|  766|Homo sapiens protein ( Homo sapiens ...    31   4.0  
AJ289233-1|CAB95766.2|  842|Homo sapiens ABC transporter umat pr...    31   4.0  
AF541977-1|AAN17334.1| 1278|Homo sapiens ATP-binding cassette pr...    31   4.0  
AF308472-1|AAG33617.1|  896|Homo sapiens ATP-binding cassette ha...    31   4.0  
AF168791-1|AAD51293.1| 1503|Homo sapiens multi-specific organic ...    31   4.0  
AF076775-1|AAF75107.1|  842|Homo sapiens MT-ABC transporter prot...    31   4.0  
AF071203-1|AAC27077.1|  893|Homo sapiens ABC transporter MOAT-B ...    31   4.0  
AF071202-1|AAC27076.1| 1325|Homo sapiens ABC transporter MOAT-B ...    31   4.0  
AF070598-1|AAC28653.1|  511|Homo sapiens ABC transporter protein.      31   4.0  
AF022853-4|AAB83981.1| 1456|Homo sapiens multidrug resistance pr...    31   4.0  
AB039371-1|BAA96733.1|  842|Homo sapiens mitochondrial ABC trans...    31   4.0  
L05628-1|AAB46616.1| 1531|Homo sapiens multidrug resistance-asso...    30   5.3  
EF419769-1|ABN79590.1| 1531|Homo sapiens ATP-binding cassette, s...    30   5.3  
BC113657-1|AAI13658.1|  673|Homo sapiens ATP-binding cassette, s...    30   5.3  
AF351824-1|AAK84663.1|  672|Homo sapiens sterolin-2 protein.           30   5.3  
AF324494-1|AAK84078.1|  673|Homo sapiens sterolin-2 protein.           30   5.3  
AF320294-1|AAG40004.1|  673|Homo sapiens ABCG8 protein.                30   5.3  
AF022853-5|AAB83982.1| 1400|Homo sapiens multidrug resistance pr...    30   5.3  
AF022853-3|AAB83980.1| 1459|Homo sapiens multidrug resistance pr...    30   5.3  
AF022853-2|AAB83983.1| 1450|Homo sapiens multidrug resistance pr...    30   5.3  
AF022853-1|AAB83979.1| 1515|Homo sapiens multidrug resistance pr...    30   5.3  
AC108476-2|AAY24011.1|  673|Homo sapiens unknown protein.              30   5.3  
AC003026-1|AAC05808.1|  691|Homo sapiens Multiple drug resistanc...    30   5.3  
AB209120-1|BAD92357.1| 1439|Homo sapiens ATP-binding cassette, s...    30   5.3  
BC125232-1|AAI25233.1| 1500|Homo sapiens ABCA6 protein protein.        30   7.0  
BC125231-1|AAI25232.1| 1500|Homo sapiens ABCA6 protein protein.        30   7.0  
AY040220-1|AAK76740.1| 1359|Homo sapiens ATP-binding cassette tr...    30   7.0  
AY028898-1|AAK30023.1| 1617|Homo sapiens ATP-binding cassette A6...    30   7.0  
AF373328-1|AAM77558.1| 1617|Homo sapiens ABC transporter ABCA6 p...    30   7.0  
AF373290-1|AAM77557.1| 1617|Homo sapiens ABC transporter ABCA6 p...    30   7.0  
X69970-1|CAA49591.1|  607|Homo sapiens h-ryk protein.                  29   9.2  
AC006154-1|AAD05023.1|  407|Homo sapiens unknown protein.              29   9.2  

>BT007451-1|AAP36119.1|  623|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 2 protein.
          Length = 623

 Score =  108 bits (259), Expect = 2e-23
 Identities = 49/69 (71%), Positives = 57/69 (82%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P S D+ I N S+TF+G ELL DT LELN GRRYGL+GLNG GKS LL+A+ +REVPIPE
Sbjct: 81  PNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE 140

Query: 431 HIDIFHLTR 457
           HIDI+HLTR
Sbjct: 141 HIDIYHLTR 149


>BC001661-1|AAH01661.1|  623|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 2 protein.
          Length = 623

 Score =  108 bits (259), Expect = 2e-23
 Identities = 49/69 (71%), Positives = 57/69 (82%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P S D+ I N S+TF+G ELL DT LELN GRRYGL+GLNG GKS LL+A+ +REVPIPE
Sbjct: 81  PNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE 140

Query: 431 HIDIFHLTR 457
           HIDI+HLTR
Sbjct: 141 HIDIYHLTR 149


>AJ005016-1|CAA06290.1|  550|Homo sapiens ABC transporter protein.
          Length = 550

 Score =  108 bits (259), Expect = 2e-23
 Identities = 49/69 (71%), Positives = 57/69 (82%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P S D+ I N S+TF+G ELL DT LELN GRRYGL+GLNG GKS LL+A+ +REVPIPE
Sbjct: 8   PNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE 67

Query: 431 HIDIFHLTR 457
           HIDI+HLTR
Sbjct: 68  HIDIYHLTR 76


>AF261092-1|AAG13903.1|  623|Homo sapiens iron inhibited ABC
           transporter 1 protein.
          Length = 623

 Score =  108 bits (259), Expect = 2e-23
 Identities = 49/69 (71%), Positives = 57/69 (82%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P S D+ I N S+TF+G ELL DT LELN GRRYGL+GLNG GKS LL+A+ +REVPIPE
Sbjct: 81  PNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE 140

Query: 431 HIDIFHLTR 457
           HIDI+HLTR
Sbjct: 141 HIDIYHLTR 149


>AF261091-1|AAG13902.1|  623|Homo sapiens iron inhibited ABC
           transporter 2 protein.
          Length = 623

 Score =  108 bits (259), Expect = 2e-23
 Identities = 49/69 (71%), Positives = 57/69 (82%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P S D+ I N S+TF+G ELL DT LELN GRRYGL+GLNG GKS LL+A+ +REVPIPE
Sbjct: 81  PNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE 140

Query: 431 HIDIFHLTR 457
           HIDI+HLTR
Sbjct: 141 HIDIYHLTR 149


>AC021097-3|AAS00379.1|  623|Homo sapiens unknown protein.
          Length = 623

 Score =  108 bits (259), Expect = 2e-23
 Identities = 49/69 (71%), Positives = 57/69 (82%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P S D+ I N S+TF+G ELL DT LELN GRRYGL+GLNG GKS LL+A+ +REVPIPE
Sbjct: 81  PNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE 140

Query: 431 HIDIFHLTR 457
           HIDI+HLTR
Sbjct: 141 HIDIYHLTR 149


>AC021097-2|AAS00378.1|  634|Homo sapiens unknown protein.
          Length = 634

 Score =  108 bits (259), Expect = 2e-23
 Identities = 49/69 (71%), Positives = 57/69 (82%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P S D+ I N S+TF+G ELL DT LELN GRRYGL+GLNG GKS LL+A+ +REVPIPE
Sbjct: 81  PNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE 140

Query: 431 HIDIFHLTR 457
           HIDI+HLTR
Sbjct: 141 HIDIYHLTR 149


>BC051884-1|AAH51884.2|  709|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 3 protein.
          Length = 709

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S D++I NF ++F    LL    + L  GRRYGLVG NG GK++LL  L  R + +P HI
Sbjct: 175 SYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHI 234

Query: 437 DIFHL 451
            + H+
Sbjct: 235 SLLHV 239


>BC051754-1|AAH51754.1|  709|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 3 protein.
          Length = 709

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S D++I NF ++F    LL    + L  GRRYGLVG NG GK++LL  L  R + +P HI
Sbjct: 175 SYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHI 234

Query: 437 DIFHL 451
            + H+
Sbjct: 235 SLLHV 239


>BC009253-1|AAH09253.1|  709|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 3 protein.
          Length = 709

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S D++I NF ++F    LL    + L  GRRYGLVG NG GK++LL  L  R + +P HI
Sbjct: 175 SYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHI 234

Query: 437 DIFHL 451
            + H+
Sbjct: 235 SLLHV 239


>AK002060-1|BAA92063.1|  709|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11198 fis, clone PLACE1007697, weakly similar to
           GCN20 PROTEIN. ).
          Length = 709

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S D++I NF ++F    LL    + L  GRRYGLVG NG GK++LL  L  R + +P HI
Sbjct: 175 SYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHI 234

Query: 437 DIFHL 451
            + H+
Sbjct: 235 SLLHV 239


>BX248518-8|CAM26017.1|  845|Homo sapiens ATP-binding cassette
           sub-family F (GCN20) member 1 protein.
          Length = 845

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 303 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 362


>BX248518-6|CAM26016.1|  807|Homo sapiens ATP-binding cassette
           sub-family F (GCN20) member 1 protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>BX119957-4|CAM25907.1|  845|Homo sapiens ATP-binding cassette
           sub-family F (GCN20) member 1 protein.
          Length = 845

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 303 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 362


>BX119957-2|CAM25906.1|  807|Homo sapiens ATP-binding cassette
           sub-family F (GCN20) member 1 protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>BX000357-8|CAI18562.1|  807|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>BX000357-6|CAI18563.1|  845|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 845

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 303 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 362


>BC112923-1|AAI12924.1|  845|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 845

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 303 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 362


>BC034488-1|AAH34488.1|  845|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 845

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 303 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 362


>BA000025-75|BAB63325.1|  807|Homo sapiens TNFalpha-inducible
           ATP-binding protein protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>AL662825-7|CAI17837.1|  845|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 845

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 303 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 362


>AL662825-6|CAI17836.1|  807|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>AL662800-8|CAI18158.1|  845|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 845

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 303 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 362


>AL662800-7|CAI18159.1|  807|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>AF027302-1|AAC70891.1|  807|Homo sapiens TNF-alpha stimulated ABC
           protein protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>AB209564-1|BAD92801.1|  593|Homo sapiens ATP-binding cassette,
           sub-family F, member 1 variant protein.
          Length = 593

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 51  DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 110


>AB202093-1|BAE78612.1|  807|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>AB103602-1|BAF31263.1|  807|Homo sapiens ABC50 protein protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>AB088096-1|BAC54928.1|  807|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 807

 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>AK092415-1|BAC03881.1|  703|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35096 fis, clone PLACE6006217, weakly similar to
           GCN20 PROTEIN. ).
          Length = 703

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 28/65 (43%), Positives = 39/65 (60%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S D++I NF ++F    LL    + L  GRRYGLVG NG GK++LL  L  R + +  HI
Sbjct: 169 SYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVSAHI 228

Query: 437 DIFHL 451
            + H+
Sbjct: 229 SLLHV 233


>BX248518-5|CAM26015.1|  340|Homo sapiens ATP-binding cassette
           sub-family F (GCN20) member 1 protein.
          Length = 340

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNG 373
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG
Sbjct: 304 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNG 340


>BX119957-1|CAM25905.1|  340|Homo sapiens ATP-binding cassette
           sub-family F (GCN20) member 1 protein.
          Length = 340

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNG 373
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG
Sbjct: 304 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNG 340


>BX000357-5|CAI18561.2|  340|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 340

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNG 373
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG
Sbjct: 304 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNG 340


>AL662825-5|CAI17835.2|  340|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 340

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNG 373
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG
Sbjct: 304 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNG 340


>AL662800-5|CAI18156.2|  340|Homo sapiens ATP-binding cassette,
           sub-family F (GCN20), member 1 protein.
          Length = 340

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNG 373
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG
Sbjct: 304 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNG 340


>AL359813-2|CAI23217.1| 1492|Homo sapiens ATP-binding cassette,
           sub-family C (CFTR/MRP), member 10 protein.
          Length = 1492

 Score = 39.5 bits (88), Expect = 0.009
 Identities = 26/73 (35%), Positives = 37/73 (50%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHLTRGGARYPIRPIVSRITI 505
           LE+  G   G+VG  GCGKSSLLAA+      +  H+ +  L++G       P +   TI
Sbjct: 621 LEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVRGLSKGFGLATQEPWIQFATI 680

Query: 506 HGRRFTNVVTGKT 544
                 N++ GKT
Sbjct: 681 R----DNILFGKT 689


>AK000002-1|BAA92227.1| 1513|Homo sapiens FLJ00002 protein protein.
          Length = 1513

 Score = 39.5 bits (88), Expect = 0.009
 Identities = 26/73 (35%), Positives = 37/73 (50%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHLTRGGARYPIRPIVSRITI 505
           LE+  G   G+VG  GCGKSSLLAA+      +  H+ +  L++G       P +   TI
Sbjct: 642 LEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVRGLSKGFGLATQEPWIQFATI 701

Query: 506 HGRRFTNVVTGKT 544
                 N++ GKT
Sbjct: 702 R----DNILFGKT 710


>AY032599-1|AAK39642.1| 1463|Homo sapiens multidrug
           resistance-associated protein 7 protein.
          Length = 1463

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHLTRGGARYPIRPIVSRITI 505
           LE+  G   G VG  GCGKSSLLAA+      +  H+ +  L++G       P +   TI
Sbjct: 592 LEVKKGMLVGTVGKVGCGKSSLLAAIAGELHRLRGHVAVRGLSKGFGLATQEPWIQFATI 651

Query: 506 HGRRFTNVVTGKT 544
                 N++ GKT
Sbjct: 652 R----DNILFGKT 660


>U83659-1|AAB71756.1|  485|Homo sapiens multidrug
           resistance-associated protein homolog protein.
          Length = 485

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+  A  R
Sbjct: 242 PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLACSR 296


>Y17151-1|CAA76658.2| 1527|Homo sapiens multidrug resistance protein 3
            (ABCC3) protein.
          Length = 1527

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+   L R
Sbjct: 1284 PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFR 1338


>M55131-1|AAC13657.1| 1480|Homo sapiens cystic fibrosis transmembrane
            conductance regulator protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>M28668-1|AAA35680.1| 1480|Homo sapiens protein ( Human cystic
            fibrosis mRNA, encoding a presumed transmembrane
            conductance regulator (CFTR). ).
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388145-1|ABD72217.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388143-1|ABD72213.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388142-1|ABD72211.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388141-1|ABD72209.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388140-1|ABD72207.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388139-1|ABD72205.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388138-1|ABD72203.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388137-1|ABD72201.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388136-1|ABD72199.1| 1321|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1321

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388135-1|ABD72197.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388134-1|ABD72195.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388133-1|ABD72193.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388132-1|ABD72191.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388131-1|ABD72189.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388130-1|ABD72187.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388129-1|ABD72185.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ388128-1|ABD72183.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ356264-1|ABC87067.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ356263-1|ABC87065.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ356262-1|ABC87063.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ356261-1|ABC87061.1| 1462|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1462

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1205 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1241


>DQ356260-1|ABC87059.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ356259-1|ABC87057.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ356258-1|ABC87055.1| 1462|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1462

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1205 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1241


>DQ356257-1|ABC87053.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ354391-1|ABC79056.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ354390-1|ABC79054.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ354389-1|ABC79052.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>DQ354388-1|ABC79050.1| 1480|Homo sapiens cystic fibrosis
            transmembrane conductance regulator ATP-binding cassette
            sub-fa protein.
          Length = 1480

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299  GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 1223 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 1259


>AY848832-1|AAW33659.1|  418|Homo sapiens cystic fibrosis
           transmembrane conductance regulator ATP-binding cassette
           subfam protein.
          Length = 418

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 350 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 386


>AY848831-1|AAW33658.1|  405|Homo sapiens cystic fibrosis
           transmembrane conductance regulator ATP-binding cassette
           subfam protein.
          Length = 405

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 337 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 373


>AY848829-1|AAW33656.1|  258|Homo sapiens cystic fibrosis
           transmembrane conductance regulator ATP-binding cassette
           subfam protein.
          Length = 258

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 67  GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 103


>AJ294545-1|CAC69553.1| 1514|Homo sapiens multidrug resistance
            associated protein protein.
          Length = 1514

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+   L R
Sbjct: 1284 PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFR 1338


>AF154001-1|AAD38185.1|  285|Homo sapiens MRP3s1 protein protein.
          Length = 285

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+   L R
Sbjct: 42  PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFR 96


>AF104943-1|AAD04170.1| 1527|Homo sapiens ABC transporter MOAT-D
            protein.
          Length = 1527

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+   L R
Sbjct: 1284 PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFR 1338


>AF085690-1|AAD02845.1| 1527|Homo sapiens multidrug
            resistance-associated protein 3 protein.
          Length = 1527

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+   L R
Sbjct: 1284 PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFR 1338


>AF083552-1|AAC34668.1| 1527|Homo sapiens canalicular multispecific
            organic anion transporter 2 protein.
          Length = 1527

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+   L R
Sbjct: 1284 PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFR 1338


>AF009670-1|AAD01430.1| 1528|Homo sapiens MRP3 protein.
          Length = 1528

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+   L R
Sbjct: 1285 PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFR 1339


>AC000061-1|AAB46340.2|  484|Homo sapiens unknown protein.
          Length = 484

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G+ +L++    ++ G+R GL+G  G GKS+LL+A  R
Sbjct: 227 GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLR 263


>AB208954-1|BAD92191.1| 1533|Homo sapiens ATP-binding cassette,
            sub-family C, member 3 isoform MRP3 variant protein.
          Length = 1533

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+   L R
Sbjct: 1290 PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFR 1344


>AB010887-1|BAA28146.1| 1527|Homo sapiens multidrug
            resistance-associated protein(MRP)-like protein-2 (MLP-2)
            protein.
          Length = 1527

 Score = 34.3 bits (75), Expect = 0.32
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P   +++  N+S+ +  G +L L+D  L ++ G + G+VG  G GKSS+   L R
Sbjct: 1284 PPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFR 1338


>X06181-1|CAA29547.1|  431|Homo sapiens P-glycoprotein (431 AA)
           protein.
          Length = 431

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 196 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 234


>M29447-1|AAA59576.1| 1280|Homo sapiens P glycoprotein protein.
          Length = 1280

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 1052 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 1090


>M23234-1|AAA36207.1| 1279|Homo sapiens protein ( Human membrane
            glycoprotein P (mdr3) mRNA, complete cds. ).
          Length = 1279

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 1051 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 1089



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           ++L+   L++  G+   LVG +GCGKS+ +  ++R   P    I+I
Sbjct: 410 KILKGLNLKVQSGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINI 455


>M14758-1|AAA59575.1| 1280|Homo sapiens PGY1 protein.
          Length = 1280

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 1052 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 1090


>EF034088-1|ABJ53424.1| 1286|Homo sapiens ATP-binding cassette,
            sub-family B (MDR/TAP), member 4 protein.
          Length = 1286

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 1051 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 1089



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           ++L+   L++  G+   LVG +GCGKS+ +  ++R   P    I+I
Sbjct: 410 KILKGLNLKVQSGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINI 455


>BC130424-1|AAI30425.1| 1280|Homo sapiens ATP-binding cassette,
            sub-family B (MDR/TAP), member 1 protein.
          Length = 1280

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 1052 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 1090


>BC042531-1|AAH42531.1| 1286|Homo sapiens ATP-binding cassette,
            sub-family B (MDR/TAP), member 4 protein.
          Length = 1286

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 1051 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 1089



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           ++L+   L++  G+   LVG +GCGKS+ +  ++R   P    I+I
Sbjct: 410 KILKGLNLKVQSGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINI 455


>AY910577-1|AAW82430.1| 1280|Homo sapiens ATP-binding cassette,
            sub-family B (MDR/TAP), member 1 protein.
          Length = 1280

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 1052 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 1090


>AF016535-1|AAB69423.1| 1279|Homo sapiens P-glycoprotein protein.
          Length = 1279

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 1051 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 1089


>AB208970-1|BAD92207.1| 1062|Homo sapiens Multidrug resistance
           protein 1 variant protein.
          Length = 1062

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           +LQ   LE+  G+   LVG +GCGKS+++  L R   P+
Sbjct: 834 VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPL 872


>X83467-1|CAA58470.1|  660|Homo sapiens 70kD peroxisomal integral
           membrane protein protein.
          Length = 660

 Score = 31.9 bits (69), Expect = 1.7
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           G  L++D   E+  G    + G NGCGKSSL   L
Sbjct: 452 GDVLIRDLNFEVRSGANVLICGPNGCGKSSLFRVL 486


>X58528-1|CAA41416.1|  659|Homo sapiens 70kDa peroxisomal membrane
           protein protein.
          Length = 659

 Score = 31.9 bits (69), Expect = 1.7
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           G  L++D   E+  G    + G NGCGKSSL   L
Sbjct: 452 GDVLIRDLNFEVRSGANVLICGPNGCGKSSLFRVL 486


>M81182-1|AAA60128.1|  659|Homo sapiens 70kDa peroxisomal membrane
           protein protein.
          Length = 659

 Score = 31.9 bits (69), Expect = 1.7
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           G  L++D   E+  G    + G NGCGKSSL   L
Sbjct: 452 GDVLIRDLNFEVRSGANVLICGPNGCGKSSLFRVL 486


>BC068509-1|AAH68509.1|  549|Homo sapiens ABCD3 protein protein.
          Length = 549

 Score = 31.9 bits (69), Expect = 1.7
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           G  L++D   E+  G    + G NGCGKSSL   L
Sbjct: 342 GDVLIRDLNFEVRSGANVLICGPNGCGKSSLFRVL 376


>BC021700-1|AAH21700.2|  395|Homo sapiens RYK protein protein.
          Length = 395

 Score = 31.9 bits (69), Expect = 1.7
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = -3

Query: 379 STPIKSD*PISSPTIQLQESILK*LTPIESN*KVSYLDISRTGCTASDPVQERASEFIF 203
           +TPI S   +  PT++++++ L+ +T +E+  KV  + ISR   T  D +QE     IF
Sbjct: 77  ATPITSS--LGYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIF 133


>AL138758-1|CAC15960.2|  659|Homo sapiens ATP-binding cassette,
           sub-family D (ALD), member 3 protein.
          Length = 659

 Score = 31.9 bits (69), Expect = 1.7
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           G  L++D   E+  G    + G NGCGKSSL   L
Sbjct: 452 GDVLIRDLNFEVRSGANVLICGPNGCGKSSLFRVL 486


>BC063829-1|AAH63829.1| 1664|Homo sapiens peroxisome
            proliferator-activated receptor gamma,
            coactivator-related 1 protein.
          Length = 1664

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -1

Query: 465  APPRVRWNMSMCSGIGTSRRLKAASNDDFPHPLSPTS 355
            +PP  RW  S CS  G SRR  ++S+       S +S
Sbjct: 1459 SPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSS 1495


>BC063806-1|AAH63806.1| 1542|Homo sapiens PPRC1 protein protein.
          Length = 1542

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -1

Query: 465  APPRVRWNMSMCSGIGTSRRLKAASNDDFPHPLSPTS 355
            +PP  RW  S CS  G SRR  ++S+       S +S
Sbjct: 1339 SPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSS 1375


>BC002561-1|AAH02561.2|  659|Homo sapiens PPRC1 protein protein.
          Length = 659

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -1

Query: 465 APPRVRWNMSMCSGIGTSRRLKAASNDDFPHPLSPTS 355
           +PP  RW  S CS  G SRR  ++S+       S +S
Sbjct: 464 SPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSS 500


>AL500527-6|CAH72219.1|  631|Homo sapiens peroxisome
           proliferator-activated receptor gamma,pus laevis)
           protein.
          Length = 631

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -1

Query: 465 APPRVRWNMSMCSGIGTSRRLKAASNDDFPHPLSPTS 355
           +PP  RW  S CS  G SRR  ++S+       S +S
Sbjct: 426 SPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSS 462


>AL500527-5|CAH72218.1| 1664|Homo sapiens peroxisome
            proliferator-activated receptor gamma,pus laevis)
            protein.
          Length = 1664

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -1

Query: 465  APPRVRWNMSMCSGIGTSRRLKAASNDDFPHPLSPTS 355
            +PP  RW  S CS  G SRR  ++S+       S +S
Sbjct: 1459 SPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSS 1495


>AF325193-1|AAK11573.1| 1664|Homo sapiens PGC-1 related co-activator
            protein.
          Length = 1664

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -1

Query: 465  APPRVRWNMSMCSGIGTSRRLKAASNDDFPHPLSPTS 355
            +PP  RW  S CS  G SRR  ++S+       S +S
Sbjct: 1459 SPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSS 1495


>AB011167-1|BAA25521.2| 1666|Homo sapiens KIAA0595 protein protein.
          Length = 1666

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -1

Query: 465  APPRVRWNMSMCSGIGTSRRLKAASNDDFPHPLSPTS 355
            +PP  RW  S CS  G SRR  ++S+       S +S
Sbjct: 1461 SPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSS 1497


>X96588-1|CAA65406.1|  577|Homo sapiens receptor tyrosine kinase
           protein.
          Length = 577

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = -3

Query: 355 PISS-PTIQLQESILK*LTPIESN*KVSYLDISRTGCTASDPVQERASEFIF 203
           PI+S PT++++++ L+ +T +E+  KV  + ISR   T  D +QE     IF
Sbjct: 264 PITSYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIF 315


>X95715-1|CAA65019.1|  453|Homo sapiens anthracycline resistance
           associated protein protein.
          Length = 453

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSEL---LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           P    I+  +F +  Y  EL   +Q    +++ G + G+VG  G GKSSL + L R
Sbjct: 210 PQGGQIEFRDFGLR-YRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLR 264


>S59184-1|AAB26341.1|  606|Homo sapiens RYK protein.
          Length = 606

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = -3

Query: 355 PISS-PTIQLQESILK*LTPIESN*KVSYLDISRTGCTASDPVQERASEFIF 203
           PI+S PT++++++ L+ +T +E+  KV  + ISR   T  D +QE     IF
Sbjct: 291 PITSYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIF 342


>BC131732-1|AAI31733.1| 1503|Homo sapiens ATP-binding cassette,
            sub-family C (CFTR/MRP), member 6 protein.
          Length = 1503

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSEL---LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P    I+  +F +  Y  EL   +Q    +++ G + G+VG  G GKSSL + L R
Sbjct: 1260 PQGGQIEFRDFGLR-YRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLR 1314


>AF381579-1|AAK59338.1|  142|Homo sapiens immunoglobulin heavy chain
           variable region protein.
          Length = 142

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 10/38 (26%), Positives = 20/38 (52%)
 Frame = -3

Query: 523 CKTTAVNCNTTHYRANWVPGPPSSQMEYVNVFRNRNLT 410
           C  + V+ N+T+Y  +W+  PP   +E++       +T
Sbjct: 41  CTVSGVSINSTNYYLSWIRQPPGKGLEWIGTIYYSGIT 78


>AF076622-1|AAC79696.1| 1503|Homo sapiens MRP6 protein.
          Length = 1503

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSEL---LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P    I+  +F +  Y  EL   +Q    +++ G + G+VG  G GKSSL + L R
Sbjct: 1260 PQGGQIEFRDFGLR-YRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLR 1314


>AB353947-1|BAF75364.1| 1257|Homo sapiens ATP-binding cassette,
           sub-family B (MDR/TAP), member 5 protein.
          Length = 1257

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++L+   L +  G    LVGLNG GKS+++  L+R
Sbjct: 402 KILKGLNLRIKSGETVALVGLNGSGKSTVVQLLQR 436


>BC043423-1|AAH43423.1|  301|Homo sapiens ABCB6 protein protein.
          Length = 301

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G E LQD    +  G+   LVG +G GKS++L  L R
Sbjct: 61  GRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFR 97


>BC000559-1|AAH00559.1|  842|Homo sapiens ATP-binding cassette,
           sub-family B (MDR/TAP), member 6 protein.
          Length = 842

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G E LQD    +  G+   LVG +G GKS++L  L R
Sbjct: 602 GRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFR 638


>AY207008-1|AAO37649.1| 1325|Homo sapiens ATP-binding cassette
            transporter C4 protein.
          Length = 1325

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 278  NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
            NF  +  G  +L+     +    + G+VG  G GKSSL++AL R   P
Sbjct: 1047 NFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEP 1094


>AY081219-1|AAL88745.1| 1325|Homo sapiens multidrug
            resistance-associated protein protein.
          Length = 1325

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 278  NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
            NF  +  G  +L+     +    + G+VG  G GKSSL++AL R   P
Sbjct: 1047 NFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEP 1094


>AL356257-1|CAI16722.1| 1325|Homo sapiens ATP-binding cassette,
            sub-family C (CFTR/MRP), member 4 protein.
          Length = 1325

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 278  NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
            NF  +  G  +L+     +    + G+VG  G GKSSL++AL R   P
Sbjct: 1047 NFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEP 1094


>AL157818-1|CAC36037.2| 1325|Homo sapiens ATP-binding cassette,
            sub-family C (CFTR/MRP), member 4 protein.
          Length = 1325

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 278  NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
            NF  +  G  +L+     +    + G+VG  G GKSSL++AL R   P
Sbjct: 1047 NFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEP 1094


>AL139381-1|CAI16589.1| 1325|Homo sapiens ATP-binding cassette,
            sub-family C (CFTR/MRP), member 4 protein.
          Length = 1325

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 278  NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
            NF  +  G  +L+     +    + G+VG  G GKSSL++AL R   P
Sbjct: 1047 NFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEP 1094


>AK057026-1|BAB71347.1|  766|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32464 fis, clone SKNMC1000251, highly similar to
           Homo sapiens MT-ABC transporter (MTABC) mRNA. ).
          Length = 766

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G E LQD    +  G+   LVG +G GKS++L  L R
Sbjct: 526 GRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFR 562


>AJ289233-1|CAB95766.2|  842|Homo sapiens ABC transporter umat
           protein.
          Length = 842

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G E LQD    +  G+   LVG +G GKS++L  L R
Sbjct: 602 GRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFR 638


>AF541977-1|AAN17334.1| 1278|Homo sapiens ATP-binding cassette protein
            C4 splice variant A protein.
          Length = 1278

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 278  NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
            NF  +  G  +L+     +    + G+VG  G GKSSL++AL R   P
Sbjct: 1000 NFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEP 1047


>AF308472-1|AAG33617.1|  896|Homo sapiens ATP-binding cassette
           half-transporter protein.
          Length = 896

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G E LQD    +  G+   LVG +G GKS++L  L R
Sbjct: 656 GRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFR 692


>AF168791-1|AAD51293.1| 1503|Homo sapiens multi-specific organic anion
            tranporter-E protein.
          Length = 1503

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 311  LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +Q    +++ G + G+VG  G GKSSL + L R
Sbjct: 1282 VQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLR 1314


>AF076775-1|AAF75107.1|  842|Homo sapiens MT-ABC transporter
           protein.
          Length = 842

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G E LQD    +  G+   LVG +G GKS++L  L R
Sbjct: 602 GRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFR 638


>AF071203-1|AAC27077.1|  893|Homo sapiens ABC transporter MOAT-B
           isoform protein.
          Length = 893

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 278 NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           NF  +  G  +L+     +    + G+VG  G GKSSL++AL R   P
Sbjct: 637 NFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEP 684


>AF071202-1|AAC27076.1| 1325|Homo sapiens ABC transporter MOAT-B
            protein.
          Length = 1325

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 278  NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
            NF  +  G  +L+     +    + G+VG  G GKSSL++AL R   P
Sbjct: 1047 NFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEP 1094


>AF070598-1|AAC28653.1|  511|Homo sapiens ABC transporter protein.
          Length = 511

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G E LQD    +  G+   LVG +G GKS++L  L R
Sbjct: 271 GRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFR 307


>AF022853-4|AAB83981.1| 1456|Homo sapiens multidrug resistance
           protein protein.
          Length = 1456

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 2/73 (2%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           +  I + N + T+  S+   L      +  G    +VG  GCGKSSLL+AL      +  
Sbjct: 625 TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 684

Query: 431 HIDIFHLTRGGAR 469
           H+ I  +   G +
Sbjct: 685 HVAIKGVNLSGGQ 697


>AB039371-1|BAA96733.1|  842|Homo sapiens mitochondrial ABC
           transporter 3 protein.
          Length = 842

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G E LQD    +  G+   LVG +G GKS++L  L R
Sbjct: 602 GRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFR 638


>L05628-1|AAB46616.1| 1531|Homo sapiens multidrug
           resistance-associated protein protein.
          Length = 1531

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           +  I + N + T+  S+   L      +  G    +VG  GCGKSSLL+AL      +  
Sbjct: 641 TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 700

Query: 431 HIDI 442
           H+ I
Sbjct: 701 HVAI 704


>EF419769-1|ABN79590.1| 1531|Homo sapiens ATP-binding cassette,
           sub-family C (CFTR/MRP), member 1 protein.
          Length = 1531

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           +  I + N + T+  S+   L      +  G    +VG  GCGKSSLL+AL      +  
Sbjct: 641 TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 700

Query: 431 HIDI 442
           H+ I
Sbjct: 701 HVAI 704


>BC113657-1|AAI13658.1|  673|Homo sapiens ATP-binding cassette,
           sub-family G (WHITE), member 8 (sterolin 2) protein.
          Length = 673

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALR-RREVPIPEHIDIFHLTRGGARYPIRPI 487
           +Q+   ++  G+   ++G +GCG++SLL  +  R      +   I+   +  +   +R  
Sbjct: 88  IQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSSPQLVRKC 147

Query: 488 VSRITIHGRRFTNVVTGKTLAF 553
           V+ +  H +   N+   +TLAF
Sbjct: 148 VAHVRQHNQLLPNLTVRETLAF 169


>AF351824-1|AAK84663.1|  672|Homo sapiens sterolin-2 protein.
          Length = 672

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALR-RREVPIPEHIDIFHLTRGGARYPIRPI 487
           +Q+   ++  G+   ++G +GCG++SLL  +  R      +   I+   +  +   +R  
Sbjct: 88  IQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSSPQLVRKC 147

Query: 488 VSRITIHGRRFTNVVTGKTLAF 553
           V+ +  H +   N+   +TLAF
Sbjct: 148 VAHVRQHNQLLPNLTVRETLAF 169


>AF324494-1|AAK84078.1|  673|Homo sapiens sterolin-2 protein.
          Length = 673

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALR-RREVPIPEHIDIFHLTRGGARYPIRPI 487
           +Q+   ++  G+   ++G +GCG++SLL  +  R      +   I+   +  +   +R  
Sbjct: 88  IQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSSPQLVRKC 147

Query: 488 VSRITIHGRRFTNVVTGKTLAF 553
           V+ +  H +   N+   +TLAF
Sbjct: 148 VAHVRQHNQLLPNLTVRETLAF 169


>AF320294-1|AAG40004.1|  673|Homo sapiens ABCG8 protein.
          Length = 673

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALR-RREVPIPEHIDIFHLTRGGARYPIRPI 487
           +Q+   ++  G+   ++G +GCG++SLL  +  R      +   I+   +  +   +R  
Sbjct: 88  IQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSSPQLVRKC 147

Query: 488 VSRITIHGRRFTNVVTGKTLAF 553
           V+ +  H +   N+   +TLAF
Sbjct: 148 VAHVRQHNQLLPNLTVRETLAF 169


>AF022853-5|AAB83982.1| 1400|Homo sapiens multidrug resistance
           protein protein.
          Length = 1400

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           +  I + N + T+  S+   L      +  G    +VG  GCGKSSLL+AL      +  
Sbjct: 625 TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 684

Query: 431 HIDI 442
           H+ I
Sbjct: 685 HVAI 688


>AF022853-3|AAB83980.1| 1459|Homo sapiens multidrug resistance
           protein protein.
          Length = 1459

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           +  I + N + T+  S+   L      +  G    +VG  GCGKSSLL+AL      +  
Sbjct: 625 TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 684

Query: 431 HIDI 442
           H+ I
Sbjct: 685 HVAI 688


>AF022853-2|AAB83983.1| 1450|Homo sapiens multidrug resistance
           protein protein.
          Length = 1450

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           +  I + N + T+  S+   L      +  G    +VG  GCGKSSLL+AL      +  
Sbjct: 625 TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 684

Query: 431 HIDI 442
           H+ I
Sbjct: 685 HVAI 688


>AF022853-1|AAB83979.1| 1515|Homo sapiens multidrug resistance
           protein protein.
          Length = 1515

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           +  I + N + T+  S+   L      +  G    +VG  GCGKSSLL+AL      +  
Sbjct: 625 TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 684

Query: 431 HIDI 442
           H+ I
Sbjct: 685 HVAI 688


>AC108476-2|AAY24011.1|  673|Homo sapiens unknown protein.
          Length = 673

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALR-RREVPIPEHIDIFHLTRGGARYPIRPI 487
           +Q+   ++  G+   ++G +GCG++SLL  +  R      +   I+   +  +   +R  
Sbjct: 88  IQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSSPQLVRKC 147

Query: 488 VSRITIHGRRFTNVVTGKTLAF 553
           V+ +  H +   N+   +TLAF
Sbjct: 148 VAHVRQHNQLLPNLTVRETLAF 169


>AC003026-1|AAC05808.1|  691|Homo sapiens Multiple drug resistance
           gene MRP1 (partial) protein.
          Length = 691

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           +  I + N + T+  S+   L      +  G    +VG  GCGKSSLL+AL      +  
Sbjct: 126 TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 185

Query: 431 HIDI 442
           H+ I
Sbjct: 186 HVAI 189


>AB209120-1|BAD92357.1| 1439|Homo sapiens ATP-binding cassette,
           sub-family C, member 1 isoform 1 variant protein.
          Length = 1439

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           +  I + N + T+  S+   L      +  G    +VG  GCGKSSLL+AL      +  
Sbjct: 539 TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 598

Query: 431 HIDI 442
           H+ I
Sbjct: 599 HVAI 602


>BC125232-1|AAI25233.1| 1500|Homo sapiens ABCA6 protein protein.
          Length = 1500

 Score = 29.9 bits (64), Expect = 7.0
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFH 448
           E L+  L ++  G+   ++G +G GKSSLL  L    VP    + I++
Sbjct: 495 EALKGLLFDIYEGQITAILGHSGAGKSSLLNILNGLSVPTEGSVTIYN 542


>BC125231-1|AAI25232.1| 1500|Homo sapiens ABCA6 protein protein.
          Length = 1500

 Score = 29.9 bits (64), Expect = 7.0
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFH 448
           E L+  L ++  G+   ++G +G GKSSLL  L    VP    + I++
Sbjct: 495 EALKGLLFDIYEGQITAILGHSGAGKSSLLNILNGLSVPTEGSVTIYN 542


>AY040220-1|AAK76740.1| 1359|Homo sapiens ATP-binding cassette
            transporter sub-family C member 12 protein.
          Length = 1359

 Score = 29.9 bits (64), Expect = 7.0
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY-GSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
            P   +I   ++ + +   + L+ D+L L +  G+  G+VG  G GKSSL  AL R   P
Sbjct: 1115 PSCGEITFRDYQMRYRDNTPLVLDSLNLNIQSGQTVGIVGRTGSGKSSLGMALFRLVEP 1173


>AY028898-1|AAK30023.1| 1617|Homo sapiens ATP-binding cassette A6
           protein.
          Length = 1617

 Score = 29.9 bits (64), Expect = 7.0
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFH 448
           E L+  L ++  G+   ++G +G GKSSLL  L    VP    + I++
Sbjct: 495 EALKGLLFDIYEGQITAILGHSGAGKSSLLNILNGLSVPTEGSVTIYN 542


>AF373328-1|AAM77558.1| 1617|Homo sapiens ABC transporter ABCA6
           protein.
          Length = 1617

 Score = 29.9 bits (64), Expect = 7.0
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFH 448
           E L+  L ++  G+   ++G +G GKSSLL  L    VP    + I++
Sbjct: 495 EALKGLLFDIYEGQITAILGHSGAGKSSLLNILNGLSVPTEGSVTIYN 542


>AF373290-1|AAM77557.1| 1617|Homo sapiens ABC transporter ABCA6
           protein.
          Length = 1617

 Score = 29.9 bits (64), Expect = 7.0
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFH 448
           E L+  L ++  G+   ++G +G GKSSLL  L    VP    + I++
Sbjct: 495 EALKGLLFDIYEGQITAILGHSGAGKSSLLNILNGLSVPTEGSVTIYN 542


>X69970-1|CAA49591.1|  607|Homo sapiens h-ryk protein.
          Length = 607

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = -3

Query: 355 PISS-PTIQLQESILK*LTPIESN*KVSYLDISRTGCTASDPVQERASEFIF 203
           PI+S PT++++++ L+ +T +E+  +V  + ISR   T  D +QE     IF
Sbjct: 294 PITSYPTLRIEKNDLRSVTLLEAKGEVKDIAISRERITLKDVLQEGTFGRIF 345


>AC006154-1|AAD05023.1|  407|Homo sapiens unknown protein.
          Length = 407

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++L+   L++  G+   LVG +GCGKS+ +  ++R
Sbjct: 365 KILKGLNLKVQSGQTVALVGSSGCGKSTTVQLIQR 399


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,741,581
Number of Sequences: 237096
Number of extensions: 1756784
Number of successful extensions: 5220
Number of sequences better than 10.0: 152
Number of HSP's better than 10.0 without gapping: 4976
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5220
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6155099854
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).