SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         152   1e-36
X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           149   7e-36
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 149   7e-36
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      149   7e-36
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      149   7e-36
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       149   7e-36
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       149   7e-36
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      149   7e-36
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       149   7e-36
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      149   7e-36
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      149   7e-36
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      149   7e-36
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      149   7e-36
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       149   7e-36
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      149   7e-36
X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   149   1e-35
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   149   1e-35
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   149   1e-35
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   149   1e-35
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         149   1e-35
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         149   1e-35
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         149   1e-35
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         149   1e-35
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         149   1e-35
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         149   1e-35
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   149   1e-35
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   149   1e-35
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   149   1e-35
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             149   1e-35
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   146   4e-35
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   146   4e-35
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               146   4e-35
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               146   4e-35
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       146   4e-35
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   146   4e-35
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             146   4e-35
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   141   1e-33
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 141   1e-33
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 141   1e-33
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               141   1e-33
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   141   1e-33
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   141   1e-33
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   141   1e-33
AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth ...   141   1e-33
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   141   1e-33
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         140   3e-33
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 140   5e-33
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   140   5e-33
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 140   5e-33
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               140   5e-33
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                140   5e-33
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               140   5e-33
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   140   5e-33
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   140   5e-33
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   140   5e-33
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   140   5e-33
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   140   5e-33
EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.          135   1e-31
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...   130   3e-30
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   126   4e-29
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        123   6e-28
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   118   1e-26
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...   109   7e-24
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.       82   1e-15
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...    82   1e-15
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...    82   1e-15
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.              82   1e-15
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...    81   2e-15
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...    81   3e-15
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.       81   3e-15
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...    81   3e-15
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...    81   3e-15
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...    81   3e-15
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...    62   2e-09
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...    62   2e-09
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...    62   2e-09
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.        60   4e-09
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.      60   4e-09
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.               60   4e-09
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.              60   4e-09
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...    60   4e-09
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...    59   1e-08
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...    59   1e-08
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...    59   1e-08
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...    59   1e-08
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...    57   4e-08
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.        56   1e-07
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.        56   1e-07
AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein prot...    56   1e-07
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.               56   1e-07
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...    56   1e-07
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.               55   2e-07
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.        55   2e-07
AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.        55   2e-07
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...    55   2e-07
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.      55   2e-07
AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein prot...    54   4e-07
AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein prot...    54   4e-07
AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein prot...    54   5e-07
AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein prot...    54   5e-07
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.        53   7e-07
AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein prot...    53   9e-07
AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein prot...    52   1e-06
AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein prot...    52   1e-06
AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein prot...    52   1e-06
AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein prot...    52   1e-06
AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein prot...    52   1e-06
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...    52   1e-06
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...    52   1e-06
AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein prot...    52   2e-06
AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein prot...    52   2e-06
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...    52   2e-06
AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein prot...    52   2e-06
AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein prot...    52   2e-06
AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein prot...    52   2e-06
AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein prot...    52   2e-06
AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein prot...    52   2e-06
AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein prot...    52   2e-06
AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein prot...    51   3e-06
AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein prot...    51   3e-06
AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein prot...    51   3e-06
AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein prot...    51   3e-06
AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein prot...    51   4e-06
AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein prot...    50   5e-06
AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein prot...    50   6e-06
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                 50   6e-06
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...    49   1e-05
AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein prot...    49   1e-05
AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein prot...    49   1e-05
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...    49   1e-05
AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein prot...    49   1e-05
AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein prot...    48   2e-05
AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein prot...    48   2e-05
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.        48   3e-05
AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein prot...    47   4e-05
AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein prot...    47   6e-05
AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein prot...    46   1e-04
AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein prot...    46   1e-04
AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein prot...    46   1e-04
AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein prot...    46   1e-04
AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein prot...    44   3e-04
AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.              44   3e-04
AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein prot...    44   4e-04
AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein prot...    44   4e-04
AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein prot...    44   4e-04
AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein prot...    44   4e-04
AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein prot...    44   4e-04
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.        44   5e-04
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.        44   5e-04
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.    44   5e-04
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.            44   5e-04
AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein prot...    43   7e-04
AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein prot...    43   0.001
AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein prot...    42   0.002
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...    41   0.004
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...    41   0.004
AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein prot...    41   0.004
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...    39   0.012
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.              39   0.012
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                 39   0.012
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.              39   0.012
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    39   0.015
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    39   0.015
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    39   0.015
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    39   0.015
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.015
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.015
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    39   0.015
BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.        38   0.027
AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.          38   0.027
AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.          38   0.027
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.         37   0.047
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.         37   0.047
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...    37   0.047
AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein prot...    36   0.14 
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...    35   0.25 
K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.                   34   0.33 
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...    34   0.44 
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...    34   0.44 
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...    34   0.44 
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...    34   0.44 
X70944-1|CAA50283.1|  707|Homo sapiens PTB-associated splicing f...    32   1.3  
BC027708-1|AAH27708.1|  525|Homo sapiens SFPQ protein protein.         32   1.3  
BC004534-1|AAH04534.2|  634|Homo sapiens SFPQ protein protein.         32   1.3  
AL590434-2|CAI12467.1|  707|Homo sapiens splicing factor proline...    32   1.3  
BC065199-1|AAH65199.1|  453|Homo sapiens family with sequence si...    32   1.8  
BC037572-1|AAH37572.1|  453|Homo sapiens family with sequence si...    32   1.8  
AF123073-1|AAK01477.1|  453|Homo sapiens C/EBP-induced protein p...    32   1.8  
BC146794-1|AAI46795.1| 1919|Homo sapiens discs, large homolog 5 ...    31   2.3  
BC073996-1|AAH73996.1|  845|Homo sapiens DLG5 protein protein.         31   2.3  
AL450306-3|CAI17324.2| 1919|Homo sapiens discs, large homolog 5 ...    31   2.3  
AL450306-2|CAI17323.1|  880|Homo sapiens discs, large homolog 5 ...    31   2.3  
AL391421-2|CAI12104.2| 1919|Homo sapiens discs, large homolog 5 ...    31   2.3  
AL391421-1|CAI12103.1|  880|Homo sapiens discs, large homolog 5 ...    31   2.3  
AF352034-1|AAL83938.1| 1809|Homo sapiens DLG5 protein.                 31   2.3  
AF352033-1|AAL83937.1| 1809|Homo sapiens DLG5 protein.                 31   2.3  
AB091676-1|BAC65420.1| 1764|Homo sapiens discs large protein lp-...    31   2.3  
AB011155-1|BAA25509.2| 1952|Homo sapiens KIAA0583 protein protein.     31   2.3  
U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-lik...    31   3.1  
AY358122-1|AAQ88489.1|  877|Homo sapiens ENWT2803 protein.             30   5.4  
AL356356-13|CAI15500.2| 1074|Homo sapiens ADAMTS-like 4 protein.       30   5.4  
AL356356-12|CAI15499.1|  877|Homo sapiens ADAMTS-like 4 protein.       30   5.4  
AF321609-1|AAT09768.1|  834|Homo sapiens titin protein.                30   7.1  
BC070228-1|AAH70228.1|   88|Homo sapiens chromosome 7 open readi...    29   9.4  
BC058930-1|AAH58930.1|  577|Homo sapiens BAT2D1 protein protein.       29   9.4  
BC006090-1|AAH06090.1|  160|Homo sapiens Unknown (protein for IM...    29   9.4  
AL096857-1|CAB51071.1| 2701|Homo sapiens hypothetical protein pr...    29   9.4  
AJ277892-6|CAD12460.1|  454|Homo sapiens Titin fetal Isoform pro...    29   9.4  
AF488829-1|AAO49478.1| 2701|Homo sapiens HBxAg transactivated pr...    29   9.4  
AF293341-1|AAK35009.1|  642|Homo sapiens collagen-like Alzheimer...    29   9.4  
AF293340-1|AAK35008.1|  654|Homo sapiens collagen-like Alzheimer...    29   9.4  
AF253978-1|AAG44627.1|  579|Homo sapiens BAT2-iso protein.             29   9.4  
AF063598-1|AAG43157.1|   88|Homo sapiens brain my040 protein pro...    29   9.4  
AB209676-1|BAD92913.1|  638|Homo sapiens actin filament associat...    29   9.4  

>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  152 bits (368), Expect = 1e-36
 Identities = 79/132 (59%), Positives = 87/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +            PPEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  101 bits (242), Expect = 2e-21
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL V P   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  149 bits (361), Expect = 7e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  102 bits (244), Expect = 1e-21
 Identities = 57/106 (53%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ +L  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAMLSLYASGRTTGIVMDSGDGVT 160


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  149 bits (360), Expect = 1e-35
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 160


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 77/134 (57%), Positives = 84/134 (62%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHP LLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNVPAM 133



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 161


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 77/134 (57%), Positives = 84/134 (62%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHP LLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNVPAM 133



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 161


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 77/134 (57%), Positives = 84/134 (62%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHP LLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNVPAM 133



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 161


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 77/134 (57%), Positives = 84/134 (62%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHP LLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNFPAM 133



 Score = 99.5 bits (237), Expect = 8e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNFPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 161


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 77/134 (57%), Positives = 84/134 (62%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHP LLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNVPAM 133



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 161


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 77/134 (57%), Positives = 84/134 (62%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHP LLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNVPAM 133



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 161


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 77/134 (57%), Positives = 84/134 (62%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHP LLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNVPAM 133



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 161


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  141 bits (342), Expect = 1e-33
 Identities = 77/135 (57%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  141 bits (342), Expect = 1e-33
 Identities = 77/135 (57%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGHEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  141 bits (342), Expect = 1e-33
 Identities = 77/135 (57%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  141 bits (342), Expect = 1e-33
 Identities = 77/135 (57%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  141 bits (342), Expect = 1e-33
 Identities = 77/135 (57%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  141 bits (342), Expect = 1e-33
 Identities = 77/135 (57%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  141 bits (342), Expect = 1e-33
 Identities = 77/135 (57%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 151

 Score =  141 bits (342), Expect = 1e-33
 Identities = 77/135 (57%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =   99 bits (238), Expect = 6e-21
 Identities = 52/93 (55%), Positives = 60/93 (64%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFR 534
           EK     + +TF  P    V IQ VL  +   R
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGR 149


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  141 bits (342), Expect = 1e-33
 Identities = 77/135 (57%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  100 bits (239), Expect = 4e-21
 Identities = 55/106 (51%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHH+FYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  140 bits (339), Expect = 3e-33
 Identities = 75/126 (59%), Positives = 80/126 (63%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K      
Sbjct: 1   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 60

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
                           +             PEEHPVLLTEAPLNPKA   KMT IMF + 
Sbjct: 61  KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF-ET 119

Query: 470 FTRPAI 487
           F  PA+
Sbjct: 120 FNTPAM 125



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 50  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 109

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 110 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 153


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (242), Expect = 2e-21
 Identities = 53/93 (56%), Positives = 60/93 (64%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFR 534
           EK     + +TF  P    V IQ VL  +   R
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGR 149


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 77/135 (57%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
           ++K                      +             PEEHP LLTEAPLNPKA   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 443 MTHIMFPKHFTRPAI 487
           MT IMF + F  PA+
Sbjct: 121 MTQIMF-ETFNVPAM 134



 Score =  101 bits (243), Expect = 1e-21
 Identities = 56/106 (52%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 119 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 162


>EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.
          Length = 121

 Score =  135 bits (326), Expect = 1e-31
 Identities = 72/122 (59%), Positives = 76/122 (62%)
 Frame = +2

Query: 119 DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXX 298
           DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K         
Sbjct: 1   DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 60

Query: 299 XXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTR 478
                        +             PEEHPVLLTEAPLNPKA   KMT IMF + F  
Sbjct: 61  IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF-ETFNT 119

Query: 479 PA 484
           PA
Sbjct: 120 PA 121



 Score =   99 bits (238), Expect = 6e-21
 Identities = 49/75 (65%), Positives = 53/75 (70%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 47  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 106

Query: 436 EKDDPYHVSKTFYTP 480
           EK     + +TF TP
Sbjct: 107 EKMTQI-MFETFNTP 120


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein.
          Length = 1075

 Score =  130 bits (315), Expect = 3e-30
 Identities = 70/132 (53%), Positives = 80/132 (60%)
 Frame = +2

Query: 92   DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
            D++ A LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPR QG+M GM QK+SYVG   ++K
Sbjct: 702  DDDTAVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSK 761

Query: 272  XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                  +             PEEHPVLLTEA LNPKA   KMT 
Sbjct: 762  RGILTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQ 821

Query: 452  IMFPKHFTRPAI 487
            IMF + F  PA+
Sbjct: 822  IMF-ETFNTPAM 832



 Score =  104 bits (250), Expect = 2e-22
 Identities = 57/106 (53%), Positives = 67/106 (63%)
 Frame = +1

Query: 256  EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
            EAQSKRG LTLKYP+EHGI+TNWDDMEKIWHHTFYNEL VAP   P      +  P+ +R
Sbjct: 757  EAQSKRGILTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANR 816

Query: 436  EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
            EK     + +TF TP    V IQ VL  +T  R      DS  G++
Sbjct: 817  EKMTQI-MFETFNTPA-MYVAIQAVLSLYTSGRTTGIVMDSGDGVT 860


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  126 bits (305), Expect = 4e-29
 Identities = 68/116 (58%), Positives = 72/116 (62%), Gaps = 1/116 (0%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKA 430
           ++K                      +             PEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116



 Score = 97.1 bits (231), Expect = 4e-20
 Identities = 43/61 (70%), Positives = 47/61 (77%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P+        P+ +R
Sbjct: 59  EAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR 118

Query: 436 E 438
           E
Sbjct: 119 E 119


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  123 bits (296), Expect = 6e-28
 Identities = 67/118 (56%), Positives = 72/118 (61%)
 Frame = +2

Query: 134 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXX 313
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K              
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 60

Query: 314 XLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
                   +             PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 61  VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANLEKMTQIMF-ETFNTPAM 117



 Score =  100 bits (240), Expect = 3e-21
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ + 
Sbjct: 42  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANL 101

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 102 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 145


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  118 bits (285), Expect = 1e-26
 Identities = 65/116 (56%), Positives = 70/116 (60%)
 Frame = +2

Query: 140 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXXXL 319
           KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K                
Sbjct: 6   KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 65

Query: 320 TGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
                 +             PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 66  NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 120



 Score =  103 bits (247), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 45  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 104

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 105 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVMDSGDGVT 148


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score =  109 bits (262), Expect = 7e-24
 Identities = 52/63 (82%), Positives = 55/63 (87%), Gaps = 1/63 (1%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRH 262
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 263 RAK 271
           ++K
Sbjct: 61  QSK 63



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 24/36 (66%), Positives = 27/36 (75%), Gaps = 2/36 (5%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVT--NWDDMEKIWHHTF 357
           EAQSKRG LTLKYPIEHGI+T  N + M +I   TF
Sbjct: 59  EAQSKRGILTLKYPIEHGIITKANREKMTQIMFETF 94


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 47/127 (37%), Positives = 63/127 (49%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP     K   + F +
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG LT++YP+EHG+V +W+DME+IW + +
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVY 94


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 47/127 (37%), Positives = 63/127 (49%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP     K   + F +
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG LT++YP+EHG+V +W+DME+IW + +
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVY 94


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 47/127 (37%), Positives = 63/127 (49%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP     K   + F +
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG LT++YP+EHG+V +W+DME+IW + +
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVY 94


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score = 82.2 bits (194), Expect = 1e-15
 Identities = 47/127 (37%), Positives = 63/127 (49%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP     K   + F +
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG LT++YP+EHG+V +W+DME+IW + +
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVY 94


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score = 81.4 bits (192), Expect = 2e-15
 Identities = 46/127 (36%), Positives = 61/127 (48%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVSP-PEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R      +   +    EEHPVLLTEAPLNP     K   + F +
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYAYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG LT++YP+EHG+V +W+DME+IW + +
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYAY 94


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 46/127 (36%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP+    +   + F +
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG L+++YP+EHGIV +W+DME+IW + +
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVY 94


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 46/127 (36%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP+    +   + F +
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG L+++YP+EHGIV +W+DME+IW + +
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVY 94


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 46/127 (36%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP+    +   + F +
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG L+++YP+EHGIV +W+DME+IW + +
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVY 94


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 46/127 (36%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP+    +   + F +
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG L+++YP+EHGIV +W+DME+IW + +
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVY 94


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 46/127 (36%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP+    +   + F +
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG L+++YP+EHGIV +W+DME+IW + +
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVY 94


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 32/62 (51%), Positives = 35/62 (56%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K   L L YPIE G+VT WDDMEK+W H F  ELGV P   P      S  P+  R
Sbjct: 60  EALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIR 119

Query: 436 EK 441
           EK
Sbjct: 120 EK 121



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 34/121 (28%), Positives = 52/121 (42%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG     K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                               +             P + PVL+TE  LNP+    K+  +M
Sbjct: 67  ALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMM 126

Query: 458 F 460
           F
Sbjct: 127 F 127


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 32/62 (51%), Positives = 35/62 (56%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K   L L YPIE G+VT WDDMEK+W H F  ELGV P   P      S  P+  R
Sbjct: 60  EALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIR 119

Query: 436 EK 441
           EK
Sbjct: 120 EK 121



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 34/121 (28%), Positives = 52/121 (42%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG     K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                               +             P + PVL+TE  LNP+    K+  +M
Sbjct: 67  ALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMM 126

Query: 458 F 460
           F
Sbjct: 127 F 127


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 32/62 (51%), Positives = 35/62 (56%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K   L L YPIE G+VT WDDMEK+W H F  ELGV P   P      S  P+  R
Sbjct: 60  EALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIR 119

Query: 436 EK 441
           EK
Sbjct: 120 EK 121



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 34/121 (28%), Positives = 52/121 (42%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG     K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                               +             P + PVL+TE  LNP+    K+  +M
Sbjct: 67  ALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMM 126

Query: 458 F 460
           F
Sbjct: 127 F 127


>BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.
          Length = 426

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 46/133 (34%), Positives = 63/133 (47%), Gaps = 8/133 (6%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGVRHRA 268
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+    + H  
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 269 KXXXXXXXXXXXXXXXL-TGM--TWRRF-GIIPSTMS--WVSPPEEHPVLLTEAPLNPKA 430
                           L  GM   W  F  I+  T S    S P  HPVL++EAP N +A
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 431 TERKMTHIMFPKH 469
              K+T +MF ++
Sbjct: 129 KREKLTELMFEQY 141


>AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.
          Length = 475

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 46/133 (34%), Positives = 63/133 (47%), Gaps = 8/133 (6%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGVRHRA 268
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+    + H  
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 269 KXXXXXXXXXXXXXXXL-TGM--TWRRF-GIIPSTMS--WVSPPEEHPVLLTEAPLNPKA 430
                           L  GM   W  F  I+  T S    S P  HPVL++EAP N +A
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 431 TERKMTHIMFPKH 469
              K+T +MF ++
Sbjct: 129 KREKLTELMFEQY 141


>AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.
          Length = 426

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 46/133 (34%), Positives = 63/133 (47%), Gaps = 8/133 (6%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGVRHRA 268
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+    + H  
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 269 KXXXXXXXXXXXXXXXL-TGM--TWRRF-GIIPSTMS--WVSPPEEHPVLLTEAPLNPKA 430
                           L  GM   W  F  I+  T S    S P  HPVL++EAP N +A
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 431 TERKMTHIMFPKH 469
              K+T +MF ++
Sbjct: 129 KREKLTELMFEQY 141


>AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.
          Length = 426

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 46/133 (34%), Positives = 63/133 (47%), Gaps = 8/133 (6%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGVRHRA 268
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+    + H  
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 269 KXXXXXXXXXXXXXXXL-TGM--TWRRF-GIIPSTMS--WVSPPEEHPVLLTEAPLNPKA 430
                           L  GM   W  F  I+  T S    S P  HPVL++EAP N +A
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 431 TERKMTHIMFPKH 469
              K+T +MF ++
Sbjct: 129 KREKLTELMFEQY 141


>AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein
           hArpN alpha protein.
          Length = 426

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 46/133 (34%), Positives = 63/133 (47%), Gaps = 8/133 (6%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGVRHRA 268
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+    + H  
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 269 KXXXXXXXXXXXXXXXL-TGM--TWRRF-GIIPSTMS--WVSPPEEHPVLLTEAPLNPKA 430
                           L  GM   W  F  I+  T S    S P  HPVL++EAP N +A
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 431 TERKMTHIMFPKH 469
              K+T +MF ++
Sbjct: 129 KREKLTELMFEQY 141


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 42/129 (32%), Positives = 57/129 (44%), Gaps = 3/129 (2%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXX 286
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG     K     
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK-QEAL 69

Query: 287 XXXXXXXXXXLTGMTWRRF-GIIPSTMSWV--SPPEEHPVLLTEAPLNPKATERKMTHIM 457
                     +TG  W     +      W     P + P+L TE  LNP+    KM  +M
Sbjct: 70  QLHSPFERGLITG--WDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVM 127

Query: 458 FPKHFTRPA 484
           F ++F  PA
Sbjct: 128 F-ENFGVPA 135



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/62 (45%), Positives = 36/62 (58%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K+  L L  P E G++T WDD+E++W H F  ELGV P   P  A   S  P+ +R
Sbjct: 61  EALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENR 120

Query: 436 EK 441
           EK
Sbjct: 121 EK 122


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 42/129 (32%), Positives = 57/129 (44%), Gaps = 3/129 (2%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXX 286
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG     K     
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK-QEAL 69

Query: 287 XXXXXXXXXXLTGMTWRRF-GIIPSTMSWV--SPPEEHPVLLTEAPLNPKATERKMTHIM 457
                     +TG  W     +      W     P + P+L TE  LNP+    KM  +M
Sbjct: 70  QLHSPFERGLITG--WDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVM 127

Query: 458 FPKHFTRPA 484
           F ++F  PA
Sbjct: 128 F-ENFGVPA 135



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/62 (45%), Positives = 36/62 (58%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K+  L L  P E G++T WDD+E++W H F  ELGV P   P  A   S  P+ +R
Sbjct: 61  EALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENR 120

Query: 436 EK 441
           EK
Sbjct: 121 EK 122


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 42/129 (32%), Positives = 57/129 (44%), Gaps = 3/129 (2%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXX 286
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG     K     
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK-QEAL 69

Query: 287 XXXXXXXXXXLTGMTWRRF-GIIPSTMSWV--SPPEEHPVLLTEAPLNPKATERKMTHIM 457
                     +TG  W     +      W     P + P+L TE  LNP+    KM  +M
Sbjct: 70  QLHSPFERGLITG--WDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVM 127

Query: 458 FPKHFTRPA 484
           F ++F  PA
Sbjct: 128 F-ENFGVPA 135



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/62 (45%), Positives = 36/62 (58%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K+  L L  P E G++T WDD+E++W H F  ELGV P   P  A   S  P+ +R
Sbjct: 61  EALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENR 120

Query: 436 EK 441
           EK
Sbjct: 121 EK 122


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 42/129 (32%), Positives = 57/129 (44%), Gaps = 3/129 (2%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXX 286
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG     K     
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK-QEAL 69

Query: 287 XXXXXXXXXXLTGMTWRRF-GIIPSTMSWV--SPPEEHPVLLTEAPLNPKATERKMTHIM 457
                     +TG  W     +      W     P + P+L TE  LNP+    KM  +M
Sbjct: 70  QLHSPFERGLITG--WDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVM 127

Query: 458 FPKHFTRPA 484
           F ++F  PA
Sbjct: 128 F-ENFGVPA 135



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/62 (45%), Positives = 36/62 (58%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K+  L L  P E G++T WDD+E++W H F  ELGV P   P  A   S  P+ +R
Sbjct: 61  EALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENR 120

Query: 436 EK 441
           EK
Sbjct: 121 EK 122


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/62 (45%), Positives = 36/62 (58%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K+  L L  P E G++T WDD+E++W H F  ELGV P   P  A   S  P+ +R
Sbjct: 60  EALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENR 119

Query: 436 EK 441
           EK
Sbjct: 120 EK 121



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 42/129 (32%), Positives = 57/129 (44%), Gaps = 3/129 (2%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXX 286
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG     K     
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK-YFVGEEALYK-QEAL 68

Query: 287 XXXXXXXXXXLTGMTWRRF-GIIPSTMSWV--SPPEEHPVLLTEAPLNPKATERKMTHIM 457
                     +TG  W     +      W     P + P+L TE  LNP+    KM  +M
Sbjct: 69  QLHSPFERGLITG--WDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVM 126

Query: 458 FPKHFTRPA 484
           F ++F  PA
Sbjct: 127 F-ENFGVPA 134


>BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.
          Length = 429

 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 47/141 (33%), Positives = 64/141 (45%), Gaps = 11/141 (7%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGVRH 262
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 263 --RAKXXXXXXXXXXXXXXXLTGMT--WRRF-GIIPST--MSWVSPPEEHPVLLTEAPLN 421
                                 GM   W  F  I+  T  M   S    HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 422 PKATERKMTHIMFPKHFTRPA 484
            +A   K+T +MF +H+  PA
Sbjct: 129 TRAKREKLTELMF-EHYNIPA 148


>BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.
          Length = 429

 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 47/141 (33%), Positives = 64/141 (45%), Gaps = 11/141 (7%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGVRH 262
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 263 --RAKXXXXXXXXXXXXXXXLTGMT--WRRF-GIIPST--MSWVSPPEEHPVLLTEAPLN 421
                                 GM   W  F  I+  T  M   S    HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 422 PKATERKMTHIMFPKHFTRPA 484
            +A   K+T +MF +H+  PA
Sbjct: 129 TRAKREKLTELMF-EHYNIPA 148


>AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PAI
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAI 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-IYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.
          Length = 429

 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 47/141 (33%), Positives = 64/141 (45%), Gaps = 11/141 (7%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGVRH 262
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 263 --RAKXXXXXXXXXXXXXXXLTGMT--WRRF-GIIPST--MSWVSPPEEHPVLLTEAPLN 421
                                 GM   W  F  I+  T  M   S    HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 422 PKATERKMTHIMFPKHFTRPA 484
            +A   K+T +MF +H+  PA
Sbjct: 129 TRAKREKLTELMF-EHYNIPA 148


>AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein
           hArpN beta protein.
          Length = 429

 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 47/141 (33%), Positives = 64/141 (45%), Gaps = 11/141 (7%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGVRH 262
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 263 --RAKXXXXXXXXXXXXXXXLTGMT--WRRF-GIIPST--MSWVSPPEEHPVLLTEAPLN 421
                                 GM   W  F  I+  T  M   S    HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 422 PKATERKMTHIMFPKHFTRPA 484
            +A   K+T +MF +H+  PA
Sbjct: 129 TRAKREKLTELMF-EHYNIPA 148


>CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.
          Length = 429

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 47/141 (33%), Positives = 64/141 (45%), Gaps = 11/141 (7%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVG--- 253
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G   
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 254 -VRHRAKXXXXXXXXXXXXXXXLTGMTWRRF-GIIPST--MSWVSPPEEHPVLLTEAPLN 421
            +   A                 T   W  F  I+  T  M   S    HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGTVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 422 PKATERKMTHIMFPKHFTRPA 484
            +A   K+T +MF +H+  PA
Sbjct: 129 TRAKREKLTELMF-EHYNIPA 148


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 36/131 (27%), Positives = 55/131 (41%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG       
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                         +   T +              PEEH VL+++ PL+P     K   +
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 455 MFPKHFTRPAI 487
           +F + F  PA+
Sbjct: 187 LF-EAFNTPAM 196



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L L  P+ HGI+ +WD ++ IW + F  E+ +AP
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAP 162


>AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 29/66 (43%), Positives = 34/66 (51%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFR 534
            +   R
Sbjct: 59  LYASGR 64


>AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 31/79 (39%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWH TFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHRTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 31/79 (39%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL V P   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVTPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 31/79 (39%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYN+L VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNKLRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANHEKMTQIMF-ETFNTPAM 49



 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 31/79 (39%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ + EK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANHEKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 28/59 (47%), Positives = 32/59 (54%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVL 513
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVL 57


>AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 47.2 bits (107), Expect = 4e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHT YNEL VAP   P         P+ +REK     + +TF TP  C V IQ VL 
Sbjct: 1   KIWHHTSYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPAMC-VAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGILMDSGDGVT 77


>AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 31/79 (39%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIW HTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWRHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNELGVAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELGVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 36/131 (27%), Positives = 55/131 (41%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG       
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                         +   T +              PEEH VL+++ PL+P     K   +
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 455 MFPKHFTRPAI 487
           +F + F  PA+
Sbjct: 187 LF-EAFNTPAM 196



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L L  P+ HGI+ +WD ++ IW + F  E+ +AP
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAP 162


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 36/131 (27%), Positives = 55/131 (41%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG       
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                         +   T +              PEEH VL+++ PL+P     K   +
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 455 MFPKHFTRPAI 487
           +F + F  PA+
Sbjct: 187 LF-EAFNTPAM 196



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L L  P+ HGI+ +WD ++ IW + F  E+ +AP
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAP 162


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 36/131 (27%), Positives = 55/131 (41%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG       
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                         +   T +              PEEH VL+++ PL+P     K   +
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 455 MFPKHFTRPAI 487
           +F + F  PA+
Sbjct: 187 LF-EAFNTPAM 196



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L L  P+ HGI+ +WD ++ IW + F  E+ +AP
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAP 162


>AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 33/79 (41%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G +
Sbjct: 59  LYTSGRTTGIVMDSGDGFT 77


>AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFY+EL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYSELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G +
Sbjct: 59  LYTSGRTTGIVMDSGDGFT 77


>AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ V  
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVPS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 34/79 (43%), Positives = 41/79 (51%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP  C V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPAMC-VAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANHEKMTQIMF-ETFNTPAM 49



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 28/63 (44%), Positives = 33/63 (52%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ + EK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFT 525
            +T
Sbjct: 59  LYT 61


>AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTRIMF-ETFNTPAM 49



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTRI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ V  
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVPS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANHEKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ + EK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVTIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVTIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANHEKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ + EK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 33/79 (41%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 26/36 (72%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IMF   F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFGT-FNTPAM 49



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 32/79 (40%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     +  TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MFGTFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 26/36 (72%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT IM  + F RPA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIML-EIFDRPAM 49



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/66 (42%), Positives = 33/66 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + + F  P    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI-MLEIFDRPA-MYVAIQAVLS 58

Query: 517 AFTPFR 534
            +T  R
Sbjct: 59  LYTSGR 64


>AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLT+APLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTQAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTQAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IM  + F RPA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIML-EIFDRPAM 49



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 31/79 (39%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + + F  P    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MLEIFDRPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 34/108 (31%), Positives = 47/108 (43%), Gaps = 1/108 (0%)
 Frame = +2

Query: 167 PRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXXXLTGMTWRR-F 343
           P+  FP+ VGRP+H  VM G  + D ++G +                          R +
Sbjct: 1   PKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIW 60

Query: 344 GIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
             + S     +  EEHPVLLTEAPLNP     K   + F + F  PA+
Sbjct: 61  QYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFF-ETFNVPAL 107



 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG LT++YP+EHG+V +W+DME+IW + +
Sbjct: 31  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVY 64


>AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 25/36 (69%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   KMT  MF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQTMF-ETFNTPAM 49



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK-MTQTMFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 24/36 (66%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPL+PKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLSPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 30/66 (45%), Positives = 35/66 (53%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLSPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFR 534
            +T  R
Sbjct: 59  LYTSGR 64


>AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 21/32 (65%), Positives = 26/32 (81%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFT 475
           P++HPVLLT+APLNP+A   KMTHIMF   +T
Sbjct: 15  PKQHPVLLTKAPLNPRANREKMTHIMFETFYT 46



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 26/66 (39%), Positives = 35/66 (53%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHH F+NEL VAP+  P         P+ +REK   + + +TFYT     V IQ +L 
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPRANREK-MTHIMFETFYTAA-MYVAIQALLS 58

Query: 517 AFTPFR 534
            +   R
Sbjct: 59  LYASGR 64


>AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 25/36 (69%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPTLLTEAPLNPKANREKMTQIMF-ETFNVPAM 49



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/79 (37%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHH+FYNEL VAP   P+        P+ +REK     + +TF  P    V IQ VL 
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI-MFETFNVPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVLDSGDGVT 77


>AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 25/36 (69%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPTLLTEAPLNPKANREKMTQIMF-ETFNVPAM 49



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/79 (37%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHH+FYNEL VAP   P+        P+ +REK     + +TF  P    V IQ VL 
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI-MFETFNVPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVLDSGDGVT 77


>AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 25/36 (69%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPL PKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLTPKANREKMTQIMF-ETFNTPAM 49



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLTPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 3/132 (2%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VG   +A+      
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVG--DQAQDWRSSL 64

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTM---SWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                    L   +W    I+   +   +    P + PVL+TE  LNP A  +++T  MF
Sbjct: 65  FISYPVERGLI-TSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITE-MF 122

Query: 461 PKHFTRPAIVPS 496
            +H   PA   S
Sbjct: 123 FEHLGVPAFYMS 134



 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           G+A    R  + G E L    +AQ  R  L + YP+E G++T+W+DME +W H +   L 
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 373 VAPRGTP 393
           + P   P
Sbjct: 95  LKPCDGP 101


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 3/132 (2%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VG   +A+      
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVG--DQAQDWRSSL 64

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTM---SWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                    L   +W    I+   +   +    P + PVL+TE  LNP A  +++T  MF
Sbjct: 65  FISYPVERGLI-TSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITE-MF 122

Query: 461 PKHFTRPAIVPS 496
            +H   PA   S
Sbjct: 123 FEHLGVPAFYMS 134



 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           G+A    R  + G E L    +AQ  R  L + YP+E G++T+W+DME +W H +   L 
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 373 VAPRGTP 393
           + P   P
Sbjct: 95  LKPCDGP 101


>AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/59 (52%), Positives = 35/59 (59%)
 Frame = +2

Query: 368 WVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           WV+P EE  VLLTEAPLNP+A   KMT IMF K F  PA+  +      L LH  G  T
Sbjct: 12  WVAP-EEQVVLLTEAPLNPRANREKMTQIMF-KTFNTPAMYVAI--QAVLSLHSSGCTT 66



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 26/59 (44%), Positives = 29/59 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVL 513
           KIW H FYNEL VAP             P+ +REK     + KTF TP    V IQ VL
Sbjct: 1   KIWDHVFYNELWVAPEEQVVLLTEAPLNPRANREKMTQI-MFKTFNTPA-MYVAIQAVL 57


>AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 24/36 (66%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNP A   KMT IMF + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPMANREKMTQIMF-ETFNTPAM 49



 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 30/66 (45%), Positives = 34/66 (51%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P  +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPMANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFR 534
            +T  R
Sbjct: 59  LYTSGR 64


>AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1
           variant protein.
          Length = 429

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 46/141 (32%), Positives = 63/141 (44%), Gaps = 11/141 (7%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGVRH 262
           +EV ALV   GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFYIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 263 R--AKXXXXXXXXXXXXXXXLTGMT--WRRF-GIIPST--MSWVSPPEEHPVLLTEAPLN 421
                                 GM   W  F  I+  T  M   S    HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 422 PKATERKMTHIMFPKHFTRPA 484
            +A   K+T +MF +H+  PA
Sbjct: 129 TRAKREKLTELMF-EHYNIPA 148


>AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 25/36 (69%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEA LNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEATLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 32/79 (40%), Positives = 41/79 (51%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           +IWHHTFYNEL VAP   P      +  P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   RIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 24/36 (66%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEAPLNPKA   ++T IMF + F  PA+
Sbjct: 15  PEEHPVLLTEAPLNPKANREEITQIMF-ETFNTPAM 49



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 30/79 (37%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHT YNEL VAP   P         P+ +RE+     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEAPLNPKANREEITQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 34/70 (48%), Positives = 37/70 (52%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVTQPGIR 559
           PEEHPVLLTEAPLNPKA   KMT I F      PAI   A +   L L+  G  T     
Sbjct: 15  PEEHPVLLTEAPLNPKA-NHKMTQITFETFSNTPAIY-MAIQAVVLSLYASGLTT----- 67

Query: 560 GLDFPGGTGV 589
           G+    G GV
Sbjct: 68  GIVMDSGNGV 77



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 15/19 (78%), Positives = 15/19 (78%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTP 393
           KIWHHTFYNEL VAP   P
Sbjct: 1   KIWHHTFYNELRVAPEEHP 19


>AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 25/36 (69%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPVLLTEA LNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHPVLLTEATLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 47.2 bits (107), Expect = 4e-05
 Identities = 32/79 (40%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHT YNEL VAP   P      +  P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEATLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 24/36 (66%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP+LLTEAPLNPKA   KMT IM  + F  PA+
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIM-SETFNTPAM 49



 Score = 47.2 bits (107), Expect = 4e-05
 Identities = 32/79 (40%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ +REK     +S+TF TP    V  Q +L 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQI-MSETFNTPA-MYVANQAMLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 21/27 (77%), Positives = 24/27 (88%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMF 460
           P++HPVLLT+APLNPKA   KMTHIMF
Sbjct: 15  PKQHPVLLTKAPLNPKANREKMTHIMF 41



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 23/66 (34%), Positives = 31/66 (46%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHH F+NEL VAP+  P         P+ +REK    H+    +      V IQ +L 
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPKANREK--MTHIMFETFNTAAMYVAIQALLS 58

Query: 517 AFTPFR 534
            +   R
Sbjct: 59  LYASGR 64


>AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 24/36 (66%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEH +LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEHSILLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 32/79 (40%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP             P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYNELRVAPEEHSILLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/36 (63%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           P+EHP+LLTEAPLNPK    KMT IMF + F  PA+
Sbjct: 15  PDEHPILLTEAPLNPKINREKMTQIMF-EAFNTPAM 49



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 29/79 (36%), Positives = 37/79 (46%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIW+HTFYNEL VAP   P         P+ +REK     + + F TP      IQ VL 
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQI-MFEAFNTPA-MYAAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/36 (63%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           P+EHP+LLTEAPLNPK    KMT IMF + F  PA+
Sbjct: 15  PDEHPILLTEAPLNPKINREKMTQIMF-EAFNTPAM 49



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 30/79 (37%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIW+HTFYNEL VAP   P         P+ +REK     + + F TP    V IQ VL 
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQI-MFEAFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/36 (63%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           P+EHP+LLTEAPLNPK    KMT IMF + F  PA+
Sbjct: 15  PDEHPILLTEAPLNPKINREKMTQIMF-EAFNTPAM 49



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 30/79 (37%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIW+HTFYNEL VAP   P         P+ +REK     + + F TP    V IQ VL 
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQI-MFEAFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 28/52 (53%), Positives = 33/52 (63%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFG 535
           PEEHPVL+TEA LNPKA   KMT IMF + F  PA+  +      L L+ FG
Sbjct: 15  PEEHPVLVTEATLNPKANREKMTQIMF-ETFNTPAMYVAI--QAVLSLYTFG 63



 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 30/79 (37%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFY E+ V P   P      +  P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHTFYKEVRVVPEEHPVLVTEATLNPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTFGRNNGIVMDSGDGVT 77


>AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 29/55 (52%), Positives = 32/55 (58%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           PEE  VLLTEAPLNP+A   KMT IMF K F  PA+  +      L LH  G  T
Sbjct: 15  PEEQVVLLTEAPLNPRANREKMTQIMF-KTFNTPAMYVAI--QAVLTLHSSGCTT 66



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 26/59 (44%), Positives = 29/59 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVL 513
           KIWHH FYN L VAP             P+ +REK     + KTF TP    V IQ VL
Sbjct: 1   KIWHHVFYNVLRVAPEEQVVLLTEAPLNPRANREKMTQI-MFKTFNTPA-MYVAIQAVL 57


>AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 26/55 (47%), Positives = 34/55 (61%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           P+EH +LLTE PLNPKA  +KMT IMF + F  PA+  +      L L+ +G  T
Sbjct: 15  PKEHRMLLTEVPLNPKANHKKMTQIMF-ETFNTPAVYMAI--QAMLSLYTYGCTT 66



 Score = 37.9 bits (84), Expect = 0.027
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPR 384
           KIWHHTFYNEL VAP+
Sbjct: 1   KIWHHTFYNELHVAPK 16


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 20/46 (43%), Positives = 28/46 (60%)
 Frame = +1

Query: 220 GRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           G    + L+   EA   R  L + YP+E+GIV NWDDM+ +W +TF
Sbjct: 48  GNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTF 93



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 35/124 (28%), Positives = 54/124 (43%), Gaps = 7/124 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVG-----VRHRA 268
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VG     +R   
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
           +               +  +    FG  P  ++         +LLTE P+NP     K+ 
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFG--PEKLN--IDTRNCKILLTEPPMNPTKNREKIV 124

Query: 449 HIMF 460
            +MF
Sbjct: 125 EVMF 128


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 20/46 (43%), Positives = 28/46 (60%)
 Frame = +1

Query: 220 GRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           G    + L+   EA   R  L + YP+E+GIV NWDDM+ +W +TF
Sbjct: 48  GNIEIKDLMVGDEASELRSTLEVNYPMENGIVRNWDDMKHLWDYTF 93



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 35/124 (28%), Positives = 54/124 (43%), Gaps = 7/124 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVG-----VRHRA 268
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VG     +R   
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSTL 68

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
           +               +  +    FG  P  ++         +LLTE P+NP     K+ 
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFG--PEKLN--IDTRNCKILLTEPPMNPTKNREKIV 124

Query: 449 HIMF 460
            +MF
Sbjct: 125 EVMF 128


>AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/35 (65%), Positives = 27/35 (77%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           +EHP+LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 16  KEHPMLLTEAPLNPKANREKMTQIMF-ETFNTPAM 49



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 31/79 (39%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VA +  P         P+ +REK     + +TF TP    V IQ +L 
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTEAPLNPKANREKMTQI-MFETFNTPA-MYVAIQAMLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 32/70 (45%), Positives = 37/70 (52%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVTQPGIR 559
           PEEHP+LLT+APLNPKA   KMT I F      PAI   A +   L L+  G  T     
Sbjct: 15  PEEHPMLLTQAPLNPKA-NHKMTQITFETFSNTPAIY-MAIQAVVLSLYASGLTT----- 67

Query: 560 GLDFPGGTGV 589
           G+    G GV
Sbjct: 68  GIVMDSGNGV 77



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTP 393
           KIWHHTFYN+L + P   P
Sbjct: 1   KIWHHTFYNKLCMTPEEHP 19


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 38/129 (29%), Positives = 57/129 (44%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VG + +        
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
                     +              +    P + PVL+TE  LNP A  +++T  MF +H
Sbjct: 67  SYPVERGLITSCEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITE-MFFEH 125

Query: 470 FTRPAIVPS 496
              PA   S
Sbjct: 126 LGVPAFYMS 134



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/67 (34%), Positives = 35/67 (52%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           G+A    R  + G E L    +AQ  R  L + YP+E G++T+ +DME +W H +   L 
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSCEDMEIMWKHIYDYNLK 94

Query: 373 VAPRGTP 393
           + P   P
Sbjct: 95  LKPCDGP 101


>AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 22/36 (61%), Positives = 26/36 (72%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           P+EHP+LLTEAPLNPK    KM  IMF + F  PA+
Sbjct: 15  PDEHPILLTEAPLNPKINREKMIQIMF-EAFNTPAM 49



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 30/79 (37%), Positives = 38/79 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIW+HTFYNEL VAP   P         P+ +REK     + + F TP    V IQ VL 
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMIQI-MFEAFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVMDSGDGVT 77


>AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 20/27 (74%), Positives = 23/27 (85%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMF 460
           P++HPVLLT+APLNPKA   KMT IMF
Sbjct: 15  PKQHPVLLTKAPLNPKANREKMTQIMF 41



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 19/35 (54%), Positives = 22/35 (62%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
           KIWHHTFYNEL VAP+  P         P+ +REK
Sbjct: 1   KIWHHTFYNELRVAPKQHPVLLTKAPLNPKANREK 35


>AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein
           protein.
          Length = 97

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 24/36 (66%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHPV LTEAP+N KA  +KMT IMF + F  PAI
Sbjct: 12  PEEHPVQLTEAPMNHKANCKKMTQIMF-ETFNTPAI 46


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 18/34 (52%), Positives = 24/34 (70%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           EA   R  L + YP+E+GIV NWDDM+ +W +TF
Sbjct: 5   EASELRSMLEVNYPMENGIVRNWDDMKHLWDYTF 38


>AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 47.2 bits (107), Expect = 4e-05
 Identities = 21/36 (58%), Positives = 28/36 (77%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           P++HP+LLT+APL+PKA   KMT IMF + F  PA+
Sbjct: 15  PKQHPMLLTKAPLDPKANREKMTQIMF-ETFNTPAM 49



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 31/79 (39%), Positives = 40/79 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHH F+NEL VAP+  P         P+ +REK     + +TF TP    V IQ VL 
Sbjct: 1   KIWHHIFHNELRVAPKQHPMLLTKAPLDPKANREKMTQI-MFETFNTPA-MYVAIQAVLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +T  R      DS  G++
Sbjct: 59  LYTSGRTTGIVMDSGDGVT 77


>AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           P+EH +LLTE PLN KA  +KMT IMF + F  PA+  +      L L+ +G  T
Sbjct: 15  PKEHRMLLTEVPLNSKANHKKMTQIMF-ETFNTPAVYMAI--QAMLSLYTYGCTT 66



 Score = 37.9 bits (84), Expect = 0.027
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPR 384
           KIWHHTFYNEL VAP+
Sbjct: 1   KIWHHTFYNELHVAPK 16


>AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein
           protein.
          Length = 102

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 21/36 (58%), Positives = 26/36 (72%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           P+EHPVLLT+ PLNPKA   K+  IMF + F  PA+
Sbjct: 14  PKEHPVLLTKVPLNPKANHEKIAQIMF-ETFNIPAM 48



 Score = 35.5 bits (78), Expect = 0.14
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTP 393
           KIWHHTFYNEL VAP+  P
Sbjct: 1   KIWHHTFYNEL-VAPKEHP 18


>AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/36 (61%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEE P+LL EAPLNPKA  +KMT I+F + F  PA+
Sbjct: 15  PEEQPMLLIEAPLNPKANCKKMTQIIF-ETFNTPAM 49



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/79 (36%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ + +K     + +TF TP    + IQT+L 
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLIEAPLNPKANCKKMTQI-IFETFNTPA-MYLAIQTMLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVLDSSDGVT 77


>AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/36 (61%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEE+ VL+T+APLNPKA   KMT IMF + F  PA+
Sbjct: 15  PEEYLVLMTKAPLNPKANREKMTQIMF-EVFNTPAM 49



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 26/66 (39%), Positives = 33/66 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYN+L VAP             P+ +REK     + + F TP    + IQ VL 
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLNPKANREKMTQI-MFEVFNTPA-MYMAIQAVLS 58

Query: 517 AFTPFR 534
            +T  R
Sbjct: 59  LYTSGR 64


>AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 21/35 (60%), Positives = 28/35 (80%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           +EHP+LLT+APL+PKA   KMT IM  + F+RPA+
Sbjct: 16  KEHPMLLTKAPLSPKANHEKMTQIML-EIFSRPAM 49



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 24/66 (36%), Positives = 31/66 (46%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VA +  P         P+ + EK     +    ++     V IQ VL 
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKAPLSPKANHEK--MTQIMLEIFSRPAMYVAIQAVLS 58

Query: 517 AFTPFR 534
            +T  R
Sbjct: 59  LYTSGR 64


>AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 27/54 (50%), Positives = 30/54 (55%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           EE  VLLTEAPLNP+A   KMT IMF K F   A+  +      L LH  G  T
Sbjct: 16  EEQVVLLTEAPLNPRANREKMTQIMF-KTFNTQAMYVAI--QAVLTLHSSGCTT 66



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 25/59 (42%), Positives = 29/59 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVL 513
           KIWHH FYNEL VA              P+ +REK     + KTF T +   V IQ VL
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLNPRANREKMTQI-MFKTFNT-QAMYVAIQAVL 57


>AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.
          Length = 109

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 16/22 (72%), Positives = 19/22 (86%)
 Frame = +1

Query: 313 VTNWDDMEKIWHHTFYNELGVA 378
           +TNWDD+EKIWHHTFY  L +A
Sbjct: 1   MTNWDDIEKIWHHTFYKGLHMA 22



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 19/26 (73%), Positives = 19/26 (73%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMF 460
           EEH VLLTE PLN KA   KMT IMF
Sbjct: 24  EEHLVLLTEDPLNLKANREKMTQIMF 49


>AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 20/35 (57%), Positives = 27/35 (77%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           +EHP+LLT+ PL+PKA  +KMT IM  + F RPA+
Sbjct: 16  KEHPMLLTKVPLSPKANHKKMTQIML-EIFDRPAM 49



 Score = 35.5 bits (78), Expect = 0.14
 Identities = 14/19 (73%), Positives = 15/19 (78%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTP 393
           KIWHHTFYNEL VA +  P
Sbjct: 1   KIWHHTFYNELCVAAKEHP 19


>AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 21/36 (58%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEE P+LL EAPLNP+A  +KMT I+F + F  PA+
Sbjct: 15  PEEQPMLLFEAPLNPRANCKKMTQIIF-ETFNTPAM 49



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 29/79 (36%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ + +K     + +TF TP    + IQT+L 
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQI-IFETFNTPA-MYLAIQTMLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVLDSSDGVT 77


>AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 21/36 (58%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEE P+LL EAPLNP+A  +KMT I+F + F  PA+
Sbjct: 15  PEEQPMLLFEAPLNPRANCKKMTQIIF-ETFNTPAM 49



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/79 (35%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           +IWHHTFYNEL VAP   P         P+ + +K     + +TF TP    + IQT+L 
Sbjct: 1   EIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQI-IFETFNTPA-MYLAIQTMLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVLDSSDGVT 77


>AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 29/79 (36%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ + +K     + +TF TP    + IQT+L 
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQI-IFETFNTPA-MYLAIQTMLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVSDSSDGVT 77



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 21/36 (58%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEE P+LL EAPLNP+A  +KMT I+F + F  PA+
Sbjct: 15  PEEQPMLLFEAPLNPRANCKKMTQIIF-ETFNTPAM 49


>AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 21/36 (58%), Positives = 27/36 (75%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEE P+LL EAPLNP+A  +KMT I+F + F  PA+
Sbjct: 15  PEEQPMLLFEAPLNPRANCKKMTQIIF-ETFNTPAM 49



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 29/79 (36%), Positives = 39/79 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VAP   P         P+ + +K     + +TF TP    + IQT+L 
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQI-IFETFNTPA-MYLAIQTMLS 58

Query: 517 AFTPFRGRYPTRDSRLGLS 573
            +   R      DS  G++
Sbjct: 59  LYASGRTTGIVLDSSDGVT 77


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 3/133 (2%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG  H     
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVG--HELLNT 105

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSP---PEEHPVLLTEAPLNPKATERKMT 448
                        +  + W     I   +   +    PEEH VL+++ PL+P +   K  
Sbjct: 106 EAPLKLVNPLKHGIV-VDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYA 164

Query: 449 HIMFPKHFTRPAI 487
            +MF + F  PA+
Sbjct: 165 ELMF-ETFGIPAM 176



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 23/83 (27%), Positives = 34/83 (40%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           GK  P   D     +  L   E  +    L L  P++HGIV +WD ++ IW + F   + 
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 373 VAPRGTPSPAH*GSPQPQGHREK 441
           + P             P  +REK
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREK 162


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 3/133 (2%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG  H     
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVG--HELLNT 105

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSP---PEEHPVLLTEAPLNPKATERKMT 448
                        +  + W     I   +   +    PEEH VL+++ PL+P +   K  
Sbjct: 106 EAPLKLVNPLKHGIV-VDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYA 164

Query: 449 HIMFPKHFTRPAI 487
            +MF + F  PA+
Sbjct: 165 ELMF-ETFGIPAM 176



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 23/83 (27%), Positives = 34/83 (40%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           GK  P   D     +  L   E  +    L L  P++HGIV +WD ++ IW + F   + 
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 373 VAPRGTPSPAH*GSPQPQGHREK 441
           + P             P  +REK
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREK 162


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 3/133 (2%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG  H     
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVG--HELLNT 105

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSP---PEEHPVLLTEAPLNPKATERKMT 448
                        +  + W     I   +   +    PEEH VL+++ PL+P +   K  
Sbjct: 106 EAPLKLVNPLKHGIV-VDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYA 164

Query: 449 HIMFPKHFTRPAI 487
            +MF + F  PA+
Sbjct: 165 ELMF-ETFGIPAM 176



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 23/83 (27%), Positives = 34/83 (40%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           GK  P   D     +  L   E  +    L L  P++HGIV +WD ++ IW + F   + 
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 373 VAPRGTPSPAH*GSPQPQGHREK 441
           + P             P  +REK
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREK 162


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 3/133 (2%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG  H     
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVG--HELLNT 105

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSP---PEEHPVLLTEAPLNPKATERKMT 448
                        +  + W     I   +   +    PEEH VL+++ PL+P +   K  
Sbjct: 106 EAPLKLVNPLKHGIV-VDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYA 164

Query: 449 HIMFPKHFTRPAI 487
            +MF + F  PA+
Sbjct: 165 ELMF-ETFGIPAM 176



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 23/83 (27%), Positives = 34/83 (40%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           GK  P   D     +  L   E  +    L L  P++HGIV +WD ++ IW + F   + 
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 373 VAPRGTPSPAH*GSPQPQGHREK 441
           + P             P  +REK
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREK 162


>AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           +EHP+LLT+ PL+PKA   KMT IM  + F RPA+
Sbjct: 16  KEHPMLLTKVPLSPKANREKMTQIML-EIFDRPAM 49



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 27/66 (40%), Positives = 33/66 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIWHHTFYNEL VA +  P         P+ +REK     + + F  P    V IQ VL 
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANREKMTQI-MLEIFDRPA-MYVAIQAVLS 58

Query: 517 AFTPFR 534
            +T  R
Sbjct: 59  LYTSGR 64


>AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 22/35 (62%), Positives = 24/35 (68%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           EEHPVLL EA  NPKA   KMT IMF + F  PA+
Sbjct: 16  EEHPVLLIEACPNPKANREKMTQIMF-ETFNSPAM 49



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 31/78 (39%), Positives = 38/78 (48%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           KIW HTFYNEL VA    P       P P+ +REK     + +TF +P    V IQ VL 
Sbjct: 1   KIWDHTFYNELCVALEEHPVLLIEACPNPKANREKMTQI-MFETFNSPA-MYVAIQPVLS 58

Query: 517 AFTPFRGRYPTRDSRLGL 570
            +   R     RDS  G+
Sbjct: 59  LYASGRTSGIVRDSGDGV 76


>AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 26/54 (48%), Positives = 29/54 (53%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           EE  VLLTE PLNP+A   KMT IMF K F   A+  +      L LH  G  T
Sbjct: 16  EEQVVLLTEPPLNPRANREKMTQIMF-KTFNTQAMYVAI--RAVLTLHSSGCTT 66



 Score = 32.3 bits (70), Expect = 1.3
 Identities = 24/59 (40%), Positives = 29/59 (49%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVL 513
           KIWHH FYNEL VA              P+ +REK     + KTF T +   V I+ VL
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEPPLNPRANREKMTQI-MFKTFNT-QAMYVAIRAVL 57


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 40.7 bits (91), Expect = 0.004
 Identities = 26/124 (20%), Positives = 49/124 (39%), Gaps = 3/124 (2%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRA--- 268
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G   R    
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPE 107

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
                              + WR   ++   +   +   +HP+L ++ P +P     K+ 
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRH--LLEHDLRVAT--HDHPLLFSDPPFSPATNREKLV 163

Query: 449 HIMF 460
            + F
Sbjct: 164 EVAF 167



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 21/54 (38%), Positives = 26/54 (48%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
           LTL  P+  GIV +WD  E IW H   ++L VA    P         P  +REK
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREK 161


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 40.7 bits (91), Expect = 0.004
 Identities = 26/124 (20%), Positives = 49/124 (39%), Gaps = 3/124 (2%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRA--- 268
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G   R    
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPE 107

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
                              + WR   ++   +   +   +HP+L ++ P +P     K+ 
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRH--LLEHDLRVAT--HDHPLLFSDPPFSPATNREKLV 163

Query: 449 HIMF 460
            + F
Sbjct: 164 EVAF 167



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 21/54 (38%), Positives = 26/54 (48%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
           LTL  P+  GIV +WD  E IW H   ++L VA    P         P  +REK
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREK 161


>AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 40.7 bits (91), Expect = 0.004
 Identities = 26/54 (48%), Positives = 29/54 (53%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           EE  VLLTEAPL P+A   KMT IMF K F   A+  +      L LH  G  T
Sbjct: 16  EEQVVLLTEAPLKPRANREKMTQIMF-KTFNTQAMYVAI--QAVLTLHSSGWTT 66



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 25/59 (42%), Positives = 30/59 (50%)
 Frame = +1

Query: 337 KIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVL 513
           KIWHH FYNEL VA             +P+ +REK     + KTF T +   V IQ VL
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLKPRANREKMTQI-MFKTFNT-QAMYVAIQAVL 57


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 38/135 (28%), Positives = 52/135 (38%), Gaps = 8/135 (5%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGVRH 262
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++G   
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
             K                  +   RF          + PE+H  LLTE PLN       
Sbjct: 67  IEKPTYATKWPIRHGIVEDWDL-MERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 443 MTHIMFPKHFTRPAI 487
              IMF + F  P +
Sbjct: 126 TAEIMF-ESFNVPGL 139



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  K  + T K+PI HGIV +WD ME+      +  L   P
Sbjct: 65  EAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEP 105


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 38/135 (28%), Positives = 52/135 (38%), Gaps = 8/135 (5%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGVRH 262
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++G   
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
             K                  +   RF          + PE+H  LLTE PLN       
Sbjct: 67  IEKPTYATKWPIRHGIVEDWDL-MERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 443 MTHIMFPKHFTRPAI 487
              IMF + F  P +
Sbjct: 126 TAEIMF-ESFNVPGL 139



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  K  + T K+PI HGIV +WD ME+      +  L   P
Sbjct: 65  EAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEP 105


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 38/135 (28%), Positives = 52/135 (38%), Gaps = 8/135 (5%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGVRH 262
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++G   
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
             K                  +   RF          + PE+H  LLTE PLN       
Sbjct: 67  IEKPTYATKWPIRHGIVEDWDL-MERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 443 MTHIMFPKHFTRPAI 487
              IMF + F  P +
Sbjct: 126 TAEIMF-ESFNVPGL 139



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  K  + T K+PI HGIV +WD ME+      +  L   P
Sbjct: 65  EAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEP 105


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 38/135 (28%), Positives = 52/135 (38%), Gaps = 8/135 (5%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGVRH 262
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++G   
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
             K                  +   RF          + PE+H  LLTE PLN       
Sbjct: 67  IEKPTYATKWPIRHGIVEDWDL-MERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 443 MTHIMFPKHFTRPAI 487
              IMF + F  P +
Sbjct: 126 TAEIMF-ESFNVPGL 139



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  K  + T K+PI HGIV +WD ME+      +  L   P
Sbjct: 65  EAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEP 105


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 110,176,676
Number of Sequences: 237096
Number of extensions: 2999157
Number of successful extensions: 9165
Number of sequences better than 10.0: 306
Number of HSP's better than 10.0 without gapping: 7434
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9099
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6297951520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).