SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         150   4e-36
X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           147   2e-35
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 147   2e-35
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      147   2e-35
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      147   2e-35
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       147   2e-35
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       147   2e-35
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      147   2e-35
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       147   2e-35
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      147   2e-35
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      147   2e-35
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      147   2e-35
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      147   2e-35
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       147   2e-35
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      147   2e-35
X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   147   3e-35
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   147   3e-35
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   147   3e-35
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   147   3e-35
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         147   3e-35
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         147   3e-35
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         147   3e-35
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         147   3e-35
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         147   3e-35
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         147   3e-35
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   147   3e-35
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   147   3e-35
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   147   3e-35
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             147   3e-35
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   146   4e-35
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   146   4e-35
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               146   4e-35
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       146   4e-35
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   146   4e-35
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             146   4e-35
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               146   8e-35
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   141   2e-33
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 141   2e-33
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               141   2e-33
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   141   2e-33
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   141   2e-33
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   141   2e-33
AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth ...   141   2e-33
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   141   2e-33
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 140   5e-33
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   140   5e-33
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 140   5e-33
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               140   5e-33
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                140   5e-33
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               140   5e-33
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   140   5e-33
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   140   5e-33
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   140   5e-33
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   140   5e-33
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   140   5e-33
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 138   1e-32
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         138   1e-32
EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.          134   3e-31
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...   126   9e-29
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   123   6e-28
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...   122   1e-27
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   122   1e-27
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        121   2e-27
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.        81   3e-15
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.       81   3e-15
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...    81   3e-15
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...    81   3e-15
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...    81   3e-15
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.              81   3e-15
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...    79   1e-14
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.       79   1e-14
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...    79   1e-14
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...    79   1e-14
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...    79   1e-14
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...    78   2e-14
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...    78   2e-14
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...    78   2e-14
AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein prot...    77   4e-14
AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein prot...    77   5e-14
AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein prot...    76   9e-14
AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein prot...    76   1e-13
AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein prot...    76   1e-13
AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein prot...    76   1e-13
AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein prot...    75   2e-13
AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein prot...    75   2e-13
AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein prot...    75   2e-13
AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein prot...    75   2e-13
AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein prot...    75   2e-13
AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein prot...    75   2e-13
AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein prot...    75   2e-13
AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein prot...    75   3e-13
AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein prot...    75   3e-13
AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein prot...    74   4e-13
AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein prot...    74   4e-13
AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein prot...    74   4e-13
AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein prot...    74   4e-13
AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein prot...    74   4e-13
AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein prot...    74   5e-13
AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein prot...    73   6e-13
AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein prot...    73   9e-13
AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein prot...    72   2e-12
AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein prot...    72   2e-12
AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein prot...    72   2e-12
AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein prot...    72   2e-12
AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein prot...    72   2e-12
AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein prot...    72   2e-12
AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.              71   3e-12
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...    70   6e-12
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...    70   6e-12
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...    70   6e-12
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...    70   6e-12
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...    70   6e-12
AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein prot...    69   1e-11
AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein prot...    69   2e-11
AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein prot...    67   4e-11
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...    67   6e-11
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...    67   6e-11
AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein prot...    66   7e-11
AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein prot...    66   1e-10
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.        65   2e-10
AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein prot...    65   2e-10
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.        65   2e-10
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...    65   2e-10
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.      65   2e-10
AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein prot...    64   3e-10
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.        64   4e-10
AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein prot...    64   4e-10
AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein prot...    64   4e-10
AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein prot...    64   4e-10
AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein prot...    64   4e-10
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                 64   4e-10
AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein prot...    64   5e-10
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...    63   7e-10
AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein prot...    63   9e-10
AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein prot...    62   1e-09
AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein prot...    62   1e-09
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.        62   2e-09
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.        62   2e-09
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.    62   2e-09
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.            62   2e-09
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...    62   2e-09
AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein prot...    62   2e-09
AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein prot...    61   3e-09
AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein prot...    60   5e-09
AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein prot...    60   5e-09
AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein prot...    60   6e-09
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...    60   9e-09
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...    60   9e-09
AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein prot...    59   1e-08
AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein prot...    58   3e-08
AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein prot...    58   3e-08
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...    57   5e-08
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.              57   5e-08
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                 57   5e-08
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.              57   5e-08
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...    57   5e-08
AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein prot...    56   8e-08
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...    55   2e-07
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...    55   2e-07
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...    55   2e-07
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...    55   2e-07
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.        47   6e-05
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.      47   6e-05
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.               47   6e-05
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.              47   6e-05
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...    47   6e-05
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.               46   1e-04
AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein prot...    46   1e-04
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.        46   1e-04
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.        46   1e-04
BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.        46   1e-04
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...    46   1e-04
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.               46   1e-04
AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.          46   1e-04
AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.          46   1e-04
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...    46   1e-04
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.         43   0.001
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.         43   0.001
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...    43   0.001
BC004223-1|AAH04223.2|   32|Homo sapiens ACTG1 protein protein.        41   0.003
U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-lik...    39   0.017
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    39   0.017
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    39   0.017
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    39   0.017
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    39   0.017
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.017
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.017
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    39   0.017
BC113036-1|AAI13037.1|  103|Homo sapiens ACTB protein protein.         38   0.030
K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.                   34   0.37 
BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.        34   0.37 
BC065199-1|AAH65199.1|  453|Homo sapiens family with sequence si...    32   1.5  
BC037572-1|AAH37572.1|  453|Homo sapiens family with sequence si...    32   1.5  
AF123073-1|AAK01477.1|  453|Homo sapiens C/EBP-induced protein p...    32   1.5  
BC146794-1|AAI46795.1| 1919|Homo sapiens discs, large homolog 5 ...    31   2.6  
BC073996-1|AAH73996.1|  845|Homo sapiens DLG5 protein protein.         31   2.6  
AL450306-3|CAI17324.2| 1919|Homo sapiens discs, large homolog 5 ...    31   2.6  
AL450306-2|CAI17323.1|  880|Homo sapiens discs, large homolog 5 ...    31   2.6  
AL391421-2|CAI12104.2| 1919|Homo sapiens discs, large homolog 5 ...    31   2.6  
AL391421-1|CAI12103.1|  880|Homo sapiens discs, large homolog 5 ...    31   2.6  
AF352034-1|AAL83938.1| 1809|Homo sapiens DLG5 protein.                 31   2.6  
AF352033-1|AAL83937.1| 1809|Homo sapiens DLG5 protein.                 31   2.6  
AB091676-1|BAC65420.1| 1764|Homo sapiens discs large protein lp-...    31   2.6  
AB011155-1|BAA25509.2| 1952|Homo sapiens KIAA0583 protein protein.     31   2.6  
Y09321-1|CAA70499.1|  801|Homo sapiens TBP associated factor pro...    30   7.9  
AL137689-1|CAB70875.1|  420|Homo sapiens hypothetical protein pr...    30   7.9  
AB234096-1|BAF51561.1|  867|Homo sapiens TATA box binding protei...    30   7.9  
AB020626-1|BAA74842.1|  989|Homo sapiens KIAA0819 protein protein.     30   7.9  

>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  150 bits (364), Expect = 4e-36
 Identities = 77/129 (59%), Positives = 82/129 (63%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +            PP      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  121 bits (291), Expect = 2e-27
 Identities = 52/58 (89%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV PEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTEAPLNPKANREK 118


>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  147 bits (357), Expect = 2e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  147 bits (356), Expect = 3e-35
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 118


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 75/131 (57%), Positives = 80/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P    + L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNVP 131



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 119


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 75/131 (57%), Positives = 80/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P    + L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNVP 131



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 119


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 75/131 (57%), Positives = 80/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P    + L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNVP 131



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 119


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 75/131 (57%), Positives = 80/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P    + L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNVP 131



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 119


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 75/131 (57%), Positives = 80/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P    + L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNVP 131



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 119


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  147 bits (355), Expect = 4e-35
 Identities = 75/131 (57%), Positives = 80/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P    + L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNVP 131



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 119


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  146 bits (353), Expect = 8e-35
 Identities = 75/131 (57%), Positives = 80/131 (61%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P    + L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFN P
Sbjct: 121 TQIMFETFNFP 131



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 119


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  141 bits (342), Expect = 2e-33
 Identities = 75/132 (56%), Positives = 81/132 (61%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  141 bits (342), Expect = 2e-33
 Identities = 75/132 (56%), Positives = 81/132 (61%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  141 bits (342), Expect = 2e-33
 Identities = 75/132 (56%), Positives = 81/132 (61%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  141 bits (342), Expect = 2e-33
 Identities = 75/132 (56%), Positives = 81/132 (61%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  141 bits (342), Expect = 2e-33
 Identities = 75/132 (56%), Positives = 81/132 (61%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  141 bits (342), Expect = 2e-33
 Identities = 75/132 (56%), Positives = 81/132 (61%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 151

 Score =  141 bits (342), Expect = 2e-33
 Identities = 75/132 (56%), Positives = 81/132 (61%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  141 bits (342), Expect = 2e-33
 Identities = 75/132 (56%), Positives = 81/132 (61%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  140 bits (338), Expect = 5e-33
 Identities = 75/132 (56%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  121 bits (291), Expect = 2e-27
 Identities = 51/58 (87%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  138 bits (335), Expect = 1e-32
 Identities = 74/132 (56%), Positives = 80/132 (60%), Gaps = 1/132 (0%)
 Frame = +3

Query: 66  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG EA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGHEA 60

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           QSKR                     +             P    + L   P  P+A   K
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 423 MTQIMFETFNTP 458
           MTQIMFETFN P
Sbjct: 121 MTQIMFETFNVP 132



 Score =  119 bits (287), Expect = 8e-27
 Identities = 50/58 (86%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  138 bits (335), Expect = 1e-32
 Identities = 73/123 (59%), Positives = 75/123 (60%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR     
Sbjct: 1   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 60

Query: 270 XXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETF 449
                           +             P      L   P  P+A   KMTQIMFETF
Sbjct: 61  KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 120

Query: 450 NTP 458
           NTP
Sbjct: 121 NTP 123



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 54  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 111


>EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.
          Length = 121

 Score =  134 bits (323), Expect = 3e-31
 Identities = 70/120 (58%), Positives = 72/120 (60%)
 Frame = +3

Query: 99  DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXXXXX 278
           DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR        
Sbjct: 1   DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 60

Query: 279 XXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
                        +             P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 61  IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 120



 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 51  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 108


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein.
          Length = 1075

 Score =  126 bits (303), Expect = 9e-29
 Identities = 67/129 (51%), Positives = 74/129 (57%)
 Frame = +3

Query: 72   DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
            D++ A LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPR QG+M GM QK+SYVG EAQSK
Sbjct: 702  DDDTAVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSK 761

Query: 252  RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
            R                     +             P      L      P+A   KMTQ
Sbjct: 762  RGILTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQ 821

Query: 432  IMFETFNTP 458
            IMFETFNTP
Sbjct: 822  IMFETFNTP 830



 Score =  122 bits (294), Expect = 1e-27
 Identities = 51/58 (87%), Positives = 56/58 (96%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYP+EHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA+LNPK NREK
Sbjct: 761 KRGILTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANREK 818


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  123 bits (296), Expect = 6e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 49  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 106



 Score =  117 bits (281), Expect = 4e-26
 Identities = 63/113 (55%), Positives = 65/113 (57%)
 Frame = +3

Query: 120 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXXXL 299
           KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR               
Sbjct: 6   KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 65

Query: 300 TGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
                 +             P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 66  NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 118


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score =  122 bits (294), Expect = 1e-27
 Identities = 58/64 (90%), Positives = 59/64 (92%), Gaps = 1/64 (1%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKR 254
           QSKR
Sbjct: 61  QSKR 64



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 18/32 (56%), Positives = 23/32 (71%), Gaps = 2/32 (6%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVT--NWDDMEKIWHHTF 337
           ++ ILTLKYPIEHGI+T  N + M +I   TF
Sbjct: 63  KRGILTLKYPIEHGIITKANREKMTQIMFETF 94



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 13/18 (72%), Positives = 14/18 (77%)
 Frame = +3

Query: 405 RATERKMTQIMFETFNTP 458
           +A   KMTQIMFETFN P
Sbjct: 80  KANREKMTQIMFETFNVP 97


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  122 bits (294), Expect = 1e-27
 Identities = 58/64 (90%), Positives = 59/64 (92%), Gaps = 1/64 (1%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 243 QSKR 254
           QSKR
Sbjct: 61  QSKR 64



 Score =  119 bits (286), Expect = 1e-26
 Identities = 50/57 (87%), Positives = 53/57 (92%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEA LNPK NRE
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  121 bits (292), Expect = 2e-27
 Identities = 65/115 (56%), Positives = 67/115 (58%)
 Frame = +3

Query: 114 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXX 293
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR             
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 60

Query: 294 XLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
                   +             P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 61  VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANLEKMTQIMFETFNTP 115



 Score =  120 bits (289), Expect = 4e-27
 Identities = 52/58 (89%), Positives = 54/58 (93%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK N EK
Sbjct: 46  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANLEK 103


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEA LNP  NREK
Sbjct: 34  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 93



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 27/105 (25%), Positives = 40/105 (38%), Gaps = 1/105 (0%)
 Frame = +3

Query: 147 PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXXXLTGMTWRR-F 323
           P+  FP+ VGRP+H  VM G  + D ++G +A+  R                     R +
Sbjct: 1   PKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIW 60

Query: 324 GIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
             + S     +        L   P  P     K  ++ FETFN P
Sbjct: 61  QYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVP 105


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEA LNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 40/124 (32%), Positives = 56/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  P     K  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEA LNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 40/124 (32%), Positives = 56/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  P     K  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEA LNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYAYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 40/124 (32%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 270 XXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLL-RLPSTPRATERKMTQIMFET 446
                           R      +   +         LL   P  P     K  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYAYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEA LNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 40/124 (32%), Positives = 56/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  P     K  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEA LNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 40/124 (32%), Positives = 56/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  P     K  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 32/60 (53%), Positives = 48/60 (80%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEA LNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 40/124 (32%), Positives = 57/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  PR    +  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 32/60 (53%), Positives = 48/60 (80%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEA LNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 40/124 (32%), Positives = 57/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  PR    +  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 32/60 (53%), Positives = 48/60 (80%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEA LNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 40/124 (32%), Positives = 57/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  PR    +  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 32/60 (53%), Positives = 48/60 (80%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEA LNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 40/124 (32%), Positives = 57/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  PR    +  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 32/60 (53%), Positives = 48/60 (80%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEA LNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 40/124 (32%), Positives = 57/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  PR    +  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 34/54 (62%), Positives = 39/54 (72%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE SLNP+  REK
Sbjct: 68  LHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREK 121



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 42/133 (31%), Positives = 64/133 (48%), Gaps = 6/133 (4%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRV 257
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYK-Y 65

Query: 258 XXXXXXXXXXXXXLTG-----MTWRRFGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATER 419
                        +TG       W+   +    +  V P  + Q  L+  PS  PR    
Sbjct: 66  EALHLHYPIERGLVTGWDDMEKLWKH--LFERELG-VKP--SQQPVLMTEPSLNPREIRE 120

Query: 420 KMTQIMFETFNTP 458
           K+ ++MFETF+ P
Sbjct: 121 KLAEMMFETFSVP 133


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 34/54 (62%), Positives = 39/54 (72%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE SLNP+  REK
Sbjct: 68  LHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREK 121



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 42/133 (31%), Positives = 64/133 (48%), Gaps = 6/133 (4%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRV 257
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYK-Y 65

Query: 258 XXXXXXXXXXXXXLTG-----MTWRRFGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATER 419
                        +TG       W+   +    +  V P  + Q  L+  PS  PR    
Sbjct: 66  EALHLHYPIERGLVTGWDDMEKLWKH--LFERELG-VKP--SQQPVLMTEPSLNPREIRE 120

Query: 420 KMTQIMFETFNTP 458
           K+ ++MFETF+ P
Sbjct: 121 KLAEMMFETFSVP 133


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 34/54 (62%), Positives = 39/54 (72%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE SLNP+  REK
Sbjct: 68  LHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREK 121



 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 42/133 (31%), Positives = 64/133 (48%), Gaps = 6/133 (4%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRV 257
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYK-Y 65

Query: 258 XXXXXXXXXXXXXLTG-----MTWRRFGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATER 419
                        +TG       W+   +    +  V P  + Q  L+  PS  PR    
Sbjct: 66  EALHLHYPIERGLVTGWDDMEKLWKH--LFERELG-VKP--SQQPVLMTEPSLNPREIRE 120

Query: 420 KMTQIMFETFNTP 458
           K+ ++MFETF+ P
Sbjct: 121 KLAEMMFETFSVP 133


>AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 38.3 bits (85), Expect = 0.023
 Identities = 17/33 (51%), Positives = 18/33 (54%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQ MFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQTMFETFNTP 47


>AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 17/33 (51%), Positives = 18/33 (54%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMF TFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFGTFNTP 47


>AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 14/33 (42%), Positives = 16/33 (48%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIM E F+ P
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMLEIFDRP 47


>AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 42/68 (61%), Positives = 44/68 (64%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREKDDPDHVRNI*HAPPCTFGIQARASR 496
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK          + P     IQA  S 
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETF-NTPAMCVAIQAVLSL 59

Query: 497 CTPSVRTT 520
            T S RTT
Sbjct: 60  YT-SGRTT 66


>AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.4 bits (182), Expect = 4e-14
 Identities = 33/35 (94%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +IWHHTFYNELRVAPEEHPVLLTEA+LNPK NREK
Sbjct: 1   RIWHHTFYNELRVAPEEHPVLLTEATLNPKANREK 35



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +3

Query: 402 PRATERKMTQIMFETFNTP 458
           P+A   KMTQIMFETFNTP
Sbjct: 29  PKANREKMTQIMFETFNTP 47


>AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 21/44 (47%), Positives = 25/44 (56%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVL 491
           P      L   P  P+A   KMTQIMFETFNTP  + +A + VL
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTPA-IYVAIQAVL 57


>AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 14/33 (42%), Positives = 16/33 (48%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIM E F+ P
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMLEIFDRP 47


>AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 17/33 (51%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMT+IMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTRIMFETFNTP 47


>AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 17/33 (51%), Positives = 18/33 (54%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIM ETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMSETFNTP 47


>AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 76.2 bits (179), Expect = 9e-14
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLT+A LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTQAPLNPKANREK 35



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 18/33 (54%), Positives = 20/33 (60%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L + P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTQAPLNPKANREKMTQIMFETFNTP 47


>AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 32/35 (91%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRV PEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVTPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHT YNELRVAPEEHPVLLTEA+LNPK NREK
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEATLNPKANREK 35



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +3

Query: 402 PRATERKMTQIMFETFNTP 458
           P+A   KMTQIMFETFNTP
Sbjct: 29  PKANREKMTQIMFETFNTP 47


>AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 32/35 (91%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYN+LRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNKLRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 32/35 (91%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK N EK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANHEK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANHEKMTQIMFETFNTP 47


>AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/35 (88%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFY+ELRVAPEEHP+LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYSELRVAPEEHPILLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/35 (88%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA L+PK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLSPKANREK 35



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 18/33 (54%), Positives = 20/33 (60%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P +P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLSPKANREKMTQIMFETFNTP 47


>AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK N EK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANHEKMTQIMFETFNTP 47


>AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK N EK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANHEKMTQIMFETFNTP 47


>AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNPK N EK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPKANHEKMTQIMFETFNTP 47


>AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 32/35 (91%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHPVLLTEA L PK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLTPKANREK 35



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 19/33 (57%), Positives = 20/33 (60%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P TP+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLTPKANREKMTQIMFETFNTP 47


>AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEHP+LLTEA LNP  NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPMANREK 35



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 18/33 (54%), Positives = 18/33 (54%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P A   KMTQIMFETFNTP
Sbjct: 15  PEEHPILLTEAPLNPMANREKMTQIMFETFNTP 47


>AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 32/35 (91%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNEL VAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELGVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 32/35 (91%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWH TFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHRTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 35



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/33 (51%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P    + L   P  P+A   KMTQIMFETFN P
Sbjct: 15  PEEHPTLLTEAPLNPKANREKMTQIMFETFNVP 47


>AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHH+FYNELRVAPEEHP LLTEA LNPK NREK
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 35



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/33 (51%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P    + L   P  P+A   KMTQIMFETFN P
Sbjct: 15  PEEHPTLLTEAPLNPKANREKMTQIMFETFNVP 47


>AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 32/35 (91%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHT YNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWHHTSYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 32/35 (91%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIW HTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 1   KIWRHTFYNELRVAPEEHPVLLTEAPLNPKANREK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEEH +LLTEA LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPEEHSILLTEAPLNPKANREK 35



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 15  PEEHSILLTEAPLNPKANREKMTQIMFETFNTP 47


>AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 6e-13
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHT YNELRVAPEEHPVLLTEA LNPK NRE+
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEAPLNPKANREE 35



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  P+A   ++TQIMFETFNTP
Sbjct: 15  PEEHPVLLTEAPLNPKANREEITQIMFETFNTP 47


>AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAP++HPVLLT+A LNPK NREK
Sbjct: 1   KIWHHTFYNELRVAPKQHPVLLTKAPLNPKANREK 35



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNT 455
           P+     L + P  P+A   KMTQIMFETFNT
Sbjct: 15  PKQHPVLLTKAPLNPKANREKMTQIMFETFNT 46


>AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 30/34 (88%), Positives = 31/34 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           KIWHHTFYNELRVAPEEHPVLLTEA LNPK N +
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANHK 34



 Score = 33.9 bits (74), Expect = 0.49
 Identities = 19/56 (33%), Positives = 28/56 (50%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRLPSVPPGI 527
           P      L   P  P+A   KMTQI FETF+    + +A + V+L++    +  GI
Sbjct: 15  PEEHPVLLTEAPLNPKANH-KMTQITFETFSNTPAIYMAIQAVVLSLYASGLTTGI 69


>AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIW+HTFYNELRVAP+EHP+LLTEA LNPK NREK
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREK 35



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 15/26 (57%), Positives = 16/26 (61%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNTP 458
           L   P  P+    KMTQIMFE FNTP
Sbjct: 22  LTEAPLNPKINREKMTQIMFEAFNTP 47


>AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIW+HTFYNELRVAP+EHP+LLTEA LNPK NREK
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREK 35



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 15/26 (57%), Positives = 16/26 (61%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNTP 458
           L   P  P+    KMTQIMFE FNTP
Sbjct: 22  LTEAPLNPKINREKMTQIMFEAFNTP 47


>AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 29/35 (82%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFY E+RV PEEHPVL+TEA+LNPK NREK
Sbjct: 1   KIWHHTFYKEVRVVPEEHPVLVTEATLNPKANREK 35



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +3

Query: 402 PRATERKMTQIMFETFNTP 458
           P+A   KMTQIMFETFNTP
Sbjct: 29  PKANREKMTQIMFETFNTP 47


>AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIW+HTFYNELRVAP+EHP+LLTEA LNPK NREK
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREK 35



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 14/26 (53%), Positives = 15/26 (57%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNTP 458
           L   P  P+    KM QIMFE FNTP
Sbjct: 22  LTEAPLNPKINREKMIQIMFEAFNTP 47


>AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIW+HTFYNELRVAP+EHP+LLTEA LNPK NREK
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREK 35



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 15/26 (57%), Positives = 16/26 (61%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNTP 458
           L   P  P+    KMTQIMFE FNTP
Sbjct: 22  LTEAPLNPKINREKMTQIMFEAFNTP 47


>AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.
          Length = 109

 Score = 70.9 bits (166), Expect = 3e-12
 Identities = 31/43 (72%), Positives = 34/43 (79%)
 Frame = +2

Query: 293 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +TNWDD+EKIWHHTFY  L +A EEH VLLTE  LN K NREK
Sbjct: 1   MTNWDDIEKIWHHTFYKGLHMALEEHLVLLTEDPLNLKANREK 43



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +3

Query: 393 PSTPRATERKMTQIMFETFNT 455
           P   +A   KMTQIMF+TFNT
Sbjct: 34  PLNLKANREKMTQIMFDTFNT 54


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 29/58 (50%), Positives = 39/58 (67%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++  L L  P E G++T WDD+E++W H F  EL V P + P+L TE SLNP+ NREK
Sbjct: 64  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREK 121



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 43/127 (33%), Positives = 58/127 (45%), Gaps = 3/127 (2%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXX 266
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+    
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK-YFVGEEALYKQ-EAL 68

Query: 267 XXXXXXXXXXLTGM--TWRRFGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATERKMTQIM 437
                     +TG     R +  +      V P  + Q  L   PS  PR    KM ++M
Sbjct: 69  QLHSPFERGLITGWDDVERLWKHLFEWELGVKP--SDQPLLATEPSLNPRENREKMAEVM 126

Query: 438 FETFNTP 458
           FE F  P
Sbjct: 127 FENFGVP 133


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 29/58 (50%), Positives = 39/58 (67%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++  L L  P E G++T WDD+E++W H F  EL V P + P+L TE SLNP+ NREK
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREK 122



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 43/127 (33%), Positives = 58/127 (45%), Gaps = 3/127 (2%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXX 266
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+    
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQ-EAL 69

Query: 267 XXXXXXXXXXLTGM--TWRRFGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATERKMTQIM 437
                     +TG     R +  +      V P  + Q  L   PS  PR    KM ++M
Sbjct: 70  QLHSPFERGLITGWDDVERLWKHLFEWELGVKP--SDQPLLATEPSLNPRENREKMAEVM 127

Query: 438 FETFNTP 458
           FE F  P
Sbjct: 128 FENFGVP 134


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 29/58 (50%), Positives = 39/58 (67%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++  L L  P E G++T WDD+E++W H F  EL V P + P+L TE SLNP+ NREK
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREK 122



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 43/127 (33%), Positives = 58/127 (45%), Gaps = 3/127 (2%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXX 266
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+    
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQ-EAL 69

Query: 267 XXXXXXXXXXLTGM--TWRRFGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATERKMTQIM 437
                     +TG     R +  +      V P  + Q  L   PS  PR    KM ++M
Sbjct: 70  QLHSPFERGLITGWDDVERLWKHLFEWELGVKP--SDQPLLATEPSLNPRENREKMAEVM 127

Query: 438 FETFNTP 458
           FE F  P
Sbjct: 128 FENFGVP 134


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 29/58 (50%), Positives = 39/58 (67%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++  L L  P E G++T WDD+E++W H F  EL V P + P+L TE SLNP+ NREK
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREK 122



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 43/127 (33%), Positives = 58/127 (45%), Gaps = 3/127 (2%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXX 266
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+    
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQ-EAL 69

Query: 267 XXXXXXXXXXLTGM--TWRRFGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATERKMTQIM 437
                     +TG     R +  +      V P  + Q  L   PS  PR    KM ++M
Sbjct: 70  QLHSPFERGLITGWDDVERLWKHLFEWELGVKP--SDQPLLATEPSLNPRENREKMAEVM 127

Query: 438 FETFNTP 458
           FE F  P
Sbjct: 128 FENFGVP 134


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 29/58 (50%), Positives = 39/58 (67%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++  L L  P E G++T WDD+E++W H F  EL V P + P+L TE SLNP+ NREK
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREK 122



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 43/127 (33%), Positives = 58/127 (45%), Gaps = 3/127 (2%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXX 266
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+    
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQ-EAL 69

Query: 267 XXXXXXXXXXLTGM--TWRRFGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATERKMTQIM 437
                     +TG     R +  +      V P  + Q  L   PS  PR    KM ++M
Sbjct: 70  QLHSPFERGLITGWDDVERLWKHLFEWELGVKP--SDQPLLATEPSLNPRENREKMAEVM 127

Query: 438 FETFNTP 458
           FE F  P
Sbjct: 128 FENFGVP 134


>AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 68.9 bits (161), Expect = 1e-11
 Identities = 39/68 (57%), Positives = 42/68 (61%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREKDDPDHVRNI*HAPPCTFGIQARASR 496
           KIWHHTFYNEL VA +EHP+LLTEA LNPK NREK          + P     IQA  S 
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQAMLSL 59

Query: 497 CTPSVRTT 520
            T S RTT
Sbjct: 60  YT-SGRTT 66


>AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 28/35 (80%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHH F+NELRVAP++HPVLLT+A LNPK NREK
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPKANREK 35



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNT 455
           P+     L + P  P+A   KMT IMFETFNT
Sbjct: 15  PKQHPVLLTKAPLNPKANREKMTHIMFETFNT 46


>AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 27/35 (77%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHH F+NELRVAP++HPVLLT+A LNP+ NREK
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPRANREK 35



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNT 455
           P+     L + P  PRA   KMT IMFETF T
Sbjct: 15  PKQHPVLLTKAPLNPRANREKMTHIMFETFYT 46


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score = 66.9 bits (156), Expect = 6e-11
 Identities = 31/83 (37%), Positives = 50/83 (60%)
 Frame = +2

Query: 173 GKAPPSGRDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 352
           G+A    R  + G E L       + +S L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 353 VAPEEHPVLLTEASLNPKGNREK 421
           + P + PVL+TE +LNP  NR++
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQ 117



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWR 61


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score = 66.9 bits (156), Expect = 6e-11
 Identities = 31/83 (37%), Positives = 50/83 (60%)
 Frame = +2

Query: 173 GKAPPSGRDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 352
           G+A    R  + G E L       + +S L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 353 VAPEEHPVLLTEASLNPKGNREK 421
           + P + PVL+TE +LNP  NR++
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQ 117



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWR 61


>AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 66.5 bits (155), Expect = 7e-11
 Identities = 52/109 (47%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREKDDPDHVRNI*HAPPCTFGIQARASR 496
           KIWHHTFYN+L VAPEE+ VL+T+A LNPK NREK     +  + + P     IQA  S 
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLNPKANREK-MTQIMFEVFNTPAMYMAIQAVLSL 59

Query: 497 CTPSVRTTRYSCWDFPGTGVFPQPVPHFTERDTPLFPHA--HFLGGFWD 637
            T S RTT     DF G GV    VP +     PL PHA  H     WD
Sbjct: 60  YT-SGRTTGI-VMDF-GDGV-AHTVPIY--EGYPL-PHAILHLDLAGWD 101


>AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 28/35 (80%), Positives = 30/35 (85%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEE P+LL EA LNPK N +K
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLIEAPLNPKANCKK 35



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 17/33 (51%), Positives = 21/33 (63%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L+  P  P+A  +KMTQI+FETFNTP
Sbjct: 15  PEEQPMLLIEAPLNPKANCKKMTQIIFETFNTP 47


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++  L+P  NREK
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREK 182



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 34/128 (26%), Positives = 51/128 (39%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
           V             +   T +              P      +   P +P     K  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 435 MFETFNTP 458
           +FE FNTP
Sbjct: 187 LFEAFNTP 194


>AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 26/35 (74%), Positives = 32/35 (91%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHH F+NELRVAP++HP+LLT+A L+PK NREK
Sbjct: 1   KIWHHIFHNELRVAPKQHPMLLTKAPLDPKANREK 35



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/33 (54%), Positives = 21/33 (63%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P+     L + P  P+A   KMTQIMFETFNTP
Sbjct: 15  PKQHPMLLTKAPLDPKANREKMTQIMFETFNTP 47


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++  L+P  NREK
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREK 182



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 34/128 (26%), Positives = 51/128 (39%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
           V             +   T +              P      +   P +P     K  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 435 MFETFNTP 458
           +FE FNTP
Sbjct: 187 LFEAFNTP 194


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++  L+P  NREK
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREK 182



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 34/128 (26%), Positives = 51/128 (39%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
           V             +   T +              P      +   P +P     K  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 435 MFETFNTP 458
           +FE FNTP
Sbjct: 187 LFEAFNTP 194


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++  L+P  NREK
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREK 182



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 34/128 (26%), Positives = 51/128 (39%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
           V             +   T +              P      +   P +P     K  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 435 MFETFNTP 458
           +FE FNTP
Sbjct: 187 LFEAFNTP 194


>AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 28/35 (80%), Positives = 29/35 (82%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHH FYN LRVAPEE  VLLTEA LNP+ NREK
Sbjct: 1   KIWHHVFYNVLRVAPEEQVVLLTEAPLNPRANREK 35



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  PRA   KMTQIMF+TFNTP
Sbjct: 15  PEEQVVLLTEAPLNPRANREKMTQIMFKTFNTP 47


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 29/61 (47%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEASLNPKGNRE 418
           +E +S+L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE  +NP  NRE
Sbjct: 7   SELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 66

Query: 419 K 421
           K
Sbjct: 67  K 67


>AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 27/35 (77%), Positives = 30/35 (85%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEE P+LL EA LNP+ N +K
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 20/33 (60%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  PRA  +KMTQI+FETFNTP
Sbjct: 15  PEEQPMLLFEAPLNPRANCKKMTQIIFETFNTP 47


>AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein
           protein.
          Length = 102

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 28/35 (80%), Positives = 30/35 (85%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNEL VAP+EHPVLLT+  LNPK N EK
Sbjct: 1   KIWHHTFYNEL-VAPKEHPVLLTKVPLNPKANHEK 34



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P+     L ++P  P+A   K+ QIMFETFN P
Sbjct: 14  PKEHPVLLTKVPLNPKANHEKIAQIMFETFNIP 46


>AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 27/35 (77%), Positives = 30/35 (85%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEE P+LL EA LNP+ N +K
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 20/33 (60%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  PRA  +KMTQI+FETFNTP
Sbjct: 15  PEEQPMLLFEAPLNPRANCKKMTQIIFETFNTP 47


>AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 27/35 (77%), Positives = 30/35 (85%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNELRVAPEE P+LL EA LNP+ N +K
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 20/33 (60%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  PRA  +KMTQI+FETFNTP
Sbjct: 15  PEEQPMLLFEAPLNPRANCKKMTQIIFETFNTP 47


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 29/61 (47%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEASLNPKGNRE 418
           +E +S+L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE  +NP  NRE
Sbjct: 62  SELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 121

Query: 419 K 421
           K
Sbjct: 122 K 122



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 5/125 (4%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRVXX 263
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA   R   
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 264 XXXXXXXXXXXLTGMTWRR---FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                            +    +   P  ++     RN +  L   P  P     K+ ++
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNI--DTRNCKILLTEPPMNPTKNREKIVEV 126

Query: 435 MFETF 449
           MFET+
Sbjct: 127 MFETY 131


>AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 26/35 (74%), Positives = 29/35 (82%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNEL VAP+EH +LLTE  LNPK N +K
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNPKANHKK 35



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVL 491
           P+  +  L  +P  P+A  +KMTQIMFETFNTP  V +A + +L
Sbjct: 15  PKEHRMLLTEVPLNPKANHKKMTQIMFETFNTPA-VYMAIQAML 57


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 29/61 (47%), Positives = 40/61 (65%), Gaps = 1/61 (1%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEASLNPKGNRE 418
           +E +S L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE  +NP  NRE
Sbjct: 62  SELRSTLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 121

Query: 419 K 421
           K
Sbjct: 122 K 122



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 5/125 (4%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRVXX 263
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA   R   
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSTL 68

Query: 264 XXXXXXXXXXXLTGMTWRR---FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                            +    +   P  ++     RN +  L   P  P     K+ ++
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNI--DTRNCKILLTEPPMNPTKNREKIVEV 126

Query: 435 MFETF 449
           MFET+
Sbjct: 127 MFETY 131


>AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 26/35 (74%), Positives = 30/35 (85%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNEL VA +EHP+LLT+  L+PK NREK
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANREK 35



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNTP 458
           L ++P +P+A   KMTQIM E F+ P
Sbjct: 22  LTKVPLSPKANREKMTQIMLEIFDRP 47


>AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 62.5 bits (145), Expect = 1e-09
 Identities = 26/35 (74%), Positives = 30/35 (85%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +IWHHTFYNELRVAPEE P+LL EA LNP+ N +K
Sbjct: 1   EIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKK 35



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 18/33 (54%), Positives = 20/33 (60%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  PRA  +KMTQI+FETFNTP
Sbjct: 15  PEEQPMLLFEAPLNPRANCKKMTQIIFETFNTP 47


>AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 62.5 bits (145), Expect = 1e-09
 Identities = 26/35 (74%), Positives = 30/35 (85%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNEL VA +EHP+LLT+A L+PK N EK
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKAPLSPKANHEK 35



 Score = 31.9 bits (69), Expect = 2.0
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNTP 458
           L + P +P+A   KMTQIM E F+ P
Sbjct: 22  LTKAPLSPKANHEKMTQIMLEIFSRP 47


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 24/54 (44%), Positives = 37/54 (68%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++  L+P  NREK
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREK 162



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 5/132 (3%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG-----DEA 242
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG      EA
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
             K V             +  + W    I  + M  +  P      +   P +P +   K
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDI-WEY--IFRTAMKIL--PEEHAVLVSDPPLSPSSNREK 162

Query: 423 MTQIMFETFNTP 458
             ++MFETF  P
Sbjct: 163 YAELMFETFGIP 174


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 24/54 (44%), Positives = 37/54 (68%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++  L+P  NREK
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREK 162



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 5/132 (3%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG-----DEA 242
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG      EA
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
             K V             +  + W    I  + M  +  P      +   P +P +   K
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDI-WEY--IFRTAMKIL--PEEHAVLVSDPPLSPSSNREK 162

Query: 423 MTQIMFETFNTP 458
             ++MFETF  P
Sbjct: 163 YAELMFETFGIP 174


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 24/54 (44%), Positives = 37/54 (68%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++  L+P  NREK
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREK 162



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 5/132 (3%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG-----DEA 242
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG      EA
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
             K V             +  + W    I  + M  +  P      +   P +P +   K
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDI-WEY--IFRTAMKIL--PEEHAVLVSDPPLSPSSNREK 162

Query: 423 MTQIMFETFNTP 458
             ++MFETF  P
Sbjct: 163 YAELMFETFGIP 174


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 24/54 (44%), Positives = 37/54 (68%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++  L+P  NREK
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREK 162



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 5/132 (3%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG-----DEA 242
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG      EA
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
             K V             +  + W    I  + M  +  P      +   P +P +   K
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDI-WEY--IFRTAMKIL--PEEHAVLVSDPPLSPSSNREK 162

Query: 423 MTQIMFETFNTP 458
             ++MFETF  P
Sbjct: 163 YAELMFETFGIP 174


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 30/83 (36%), Positives = 49/83 (59%)
 Frame = +2

Query: 173 GKAPPSGRDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 352
           G+A    R  + G E L       + +S L + YP+E G++T+ +DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSCEDMEIMWKHIYDYNLK 94

Query: 353 VAPEEHPVLLTEASLNPKGNREK 421
           + P + PVL+TE +LNP  NR++
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQ 117



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWR 61


>AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 24/34 (70%), Positives = 29/34 (85%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           KIWHHTFYN+L + PEEHP+LLT+A LNPK N +
Sbjct: 1   KIWHHTFYNKLCMTPEEHPMLLTQAPLNPKANHK 34



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +3

Query: 348 CVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRLPSVPPGI 527
           C++P  +    L + P  P+A   KMTQI FETF+    + +A + V+L++    +  GI
Sbjct: 12  CMTPEEHPM-LLTQAPLNPKANH-KMTQITFETFSNTPAIYMAIQAVVLSLYASGLTTGI 69


>AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 28/35 (80%), Positives = 28/35 (80%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIW HTFYNEL VA EEHPVLL EA  NPK NREK
Sbjct: 1   KIWDHTFYNELCVALEEHPVLLIEACPNPKANREK 35



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 19/37 (51%), Positives = 25/37 (67%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVL 491
           L+     P+A   KMTQIMFETFN+P  + +A +PVL
Sbjct: 22  LIEACPNPKANREKMTQIMFETFNSPA-MYVAIQPVL 57


>AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 25/35 (71%), Positives = 28/35 (80%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNEL VAP+EH +LLTE  LN K N +K
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNSKANHKK 35



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVL 491
           P+  +  L  +P   +A  +KMTQIMFETFNTP  V +A + +L
Sbjct: 15  PKEHRMLLTEVPLNSKANHKKMTQIMFETFNTPA-VYMAIQAML 57


>AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 27/35 (77%), Positives = 28/35 (80%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIW H FYNEL VAPEE  VLLTEA LNP+ NREK
Sbjct: 1   KIWDHVFYNELWVAPEEQVVLLTEAPLNPRANREK 35



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +3

Query: 360 PRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
           P      L   P  PRA   KMTQIMF+TFNTP
Sbjct: 15  PEEQVVLLTEAPLNPRANREKMTQIMFKTFNTP 47


>AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 60.1 bits (139), Expect = 6e-09
 Identities = 27/35 (77%), Positives = 28/35 (80%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHH FYNEL VA EE  VLLTEA LNP+ NREK
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLNPRANREK 35



 Score = 36.7 bits (81), Expect = 0.069
 Identities = 16/25 (64%), Positives = 17/25 (68%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNT 455
           L   P  PRA   KMTQIMF+TFNT
Sbjct: 22  LTEAPLNPRANREKMTQIMFKTFNT 46


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 25/54 (46%), Positives = 34/54 (62%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++   +P  NREK
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREK 161



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 25/54 (46%), Positives = 34/54 (62%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++   +P  NREK
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREK 161



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 24/35 (68%), Positives = 29/35 (82%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHHTFYNEL VA +EHP+LLT+  L+PK N +K
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANHKK 35



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNTP 458
           L ++P +P+A  +KMTQIM E F+ P
Sbjct: 22  LTKVPLSPKANHKKMTQIMLEIFDRP 47


>AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 26/35 (74%), Positives = 27/35 (77%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHH FYNEL VA EE  VLLTE  LNP+ NREK
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEPPLNPRANREK 35



 Score = 36.3 bits (80), Expect = 0.091
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = +3

Query: 393 PSTPRATERKMTQIMFETFNTPRHVRLAFKPVL 491
           P  PRA   KMTQIMF+TFNT + + +A + VL
Sbjct: 26  PLNPRANREKMTQIMFKTFNT-QAMYVAIRAVL 57


>AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 26/35 (74%), Positives = 27/35 (77%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           KIWHH FYNEL VA EE  VLLTEA L P+ NREK
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLKPRANREK 35



 Score = 36.3 bits (80), Expect = 0.091
 Identities = 16/25 (64%), Positives = 17/25 (68%)
 Frame = +3

Query: 381 LLRLPSTPRATERKMTQIMFETFNT 455
           L   P  PRA   KMTQIMF+TFNT
Sbjct: 22  LTEAPLKPRANREKMTQIMFKTFNT 46


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 26/57 (45%), Positives = 32/57 (56%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +K     K+PI HGIV +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 68  EKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENRE 124



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 242
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 243 QSK 251
             K
Sbjct: 67  IEK 69


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 26/57 (45%), Positives = 32/57 (56%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +K     K+PI HGIV +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 68  EKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENRE 124



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 242
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 243 QSK 251
             K
Sbjct: 67  IEK 69


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 26/57 (45%), Positives = 32/57 (56%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +K     K+PI HGIV +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 68  EKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENRE 124



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 242
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 243 QSK 251
             K
Sbjct: 67  IEK 69


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 26/57 (45%), Positives = 32/57 (56%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +K     K+PI HGIV +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 68  EKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENRE 124



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 242
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 243 QSK 251
             K
Sbjct: 67  IEK 69


>AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related protein
           3 homolog variant protein.
          Length = 369

 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 26/57 (45%), Positives = 32/57 (56%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +K     K+PI HGIV +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 19  EKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENRE 75


>AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 24/34 (70%), Positives = 28/34 (82%)
 Frame = +2

Query: 317 KIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           KIWHHTFYN+L VAPEE+ VL+T+A L  K NRE
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLMTKANRE 34


>BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 348

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 24/56 (42%), Positives = 31/56 (55%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           K     K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE  LN   NRE
Sbjct: 69  KPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENRE 124



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)
 Frame = +3

Query: 93  VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 248
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 249 K 251
           K
Sbjct: 69  K 69


>BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 418

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 24/56 (42%), Positives = 31/56 (55%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           K     K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE  LN   NRE
Sbjct: 69  KPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENRE 124



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)
 Frame = +3

Query: 93  VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 248
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 249 K 251
           K
Sbjct: 69  K 69


>AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein ARP4
           protein.
          Length = 402

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 24/56 (42%), Positives = 31/56 (55%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           K     K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE  LN   NRE
Sbjct: 50  KPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENRE 105


>AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein
           3-beta protein.
          Length = 418

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 24/56 (42%), Positives = 31/56 (55%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           K     K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE  LN   NRE
Sbjct: 69  KPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENRE 124



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)
 Frame = +3

Query: 93  VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 248
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 249 K 251
           K
Sbjct: 69  K 69


>BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.
          Length = 426

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 41/136 (30%), Positives = 57/136 (41%), Gaps = 8/136 (5%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVG-DEAQ 245
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+         
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 246 SKRVXXXXXXXXXXXXXLTGM--TWRRF-GIIPSTMS--CVSPPRNTQSCLLRLPSTPRA 410
           +  +               GM   W  F  I+  T S    S P      +   P   RA
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 411 TERKMTQIMFETFNTP 458
              K+T++MFE +N P
Sbjct: 129 KREKLTELMFEQYNIP 144



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P+++G++ +W+    I  HT+   ++  P  HPVL++EA  N +  REK
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREK 132


>AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.
          Length = 475

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 41/136 (30%), Positives = 57/136 (41%), Gaps = 8/136 (5%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVG-DEAQ 245
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+         
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 246 SKRVXXXXXXXXXXXXXLTGM--TWRRF-GIIPSTMS--CVSPPRNTQSCLLRLPSTPRA 410
           +  +               GM   W  F  I+  T S    S P      +   P   RA
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 411 TERKMTQIMFETFNTP 458
              K+T++MFE +N P
Sbjct: 129 KREKLTELMFEQYNIP 144



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P+++G++ +W+    I  HT+   ++  P  HPVL++EA  N +  REK
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREK 132


>AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.
          Length = 426

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 41/136 (30%), Positives = 57/136 (41%), Gaps = 8/136 (5%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVG-DEAQ 245
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+         
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 246 SKRVXXXXXXXXXXXXXLTGM--TWRRF-GIIPSTMS--CVSPPRNTQSCLLRLPSTPRA 410
           +  +               GM   W  F  I+  T S    S P      +   P   RA
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 411 TERKMTQIMFETFNTP 458
              K+T++MFE +N P
Sbjct: 129 KREKLTELMFEQYNIP 144



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P+++G++ +W+    I  HT+   ++  P  HPVL++EA  N +  REK
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREK 132


>AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.
          Length = 426

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 41/136 (30%), Positives = 57/136 (41%), Gaps = 8/136 (5%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVG-DEAQ 245
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+         
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 246 SKRVXXXXXXXXXXXXXLTGM--TWRRF-GIIPSTMS--CVSPPRNTQSCLLRLPSTPRA 410
           +  +               GM   W  F  I+  T S    S P      +   P   RA
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 411 TERKMTQIMFETFNTP 458
              K+T++MFE +N P
Sbjct: 129 KREKLTELMFEQYNIP 144



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P+++G++ +W+    I  HT+   ++  P  HPVL++EA  N +  REK
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREK 132


>AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein
           hArpN alpha protein.
          Length = 426

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 41/136 (30%), Positives = 57/136 (41%), Gaps = 8/136 (5%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVG-DEAQ 245
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+         
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 246 SKRVXXXXXXXXXXXXXLTGM--TWRRF-GIIPSTMS--CVSPPRNTQSCLLRLPSTPRA 410
           +  +               GM   W  F  I+  T S    S P      +   P   RA
Sbjct: 69  TNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRA 128

Query: 411 TERKMTQIMFETFNTP 458
              K+T++MFE +N P
Sbjct: 129 KREKLTELMFEQYNIP 144



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P+++G++ +W+    I  HT+   ++  P  HPVL++EA  N +  REK
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREK 132


>CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.
          Length = 429

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 42/139 (30%), Positives = 59/139 (42%), Gaps = 11/139 (7%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGD-- 236
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G   
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 237 --EAQSKRVXXXXXXXXXXXXXLTGMTWRRF-GIIPSTMSC-VSPPRNTQSCLL-RLPST 401
             +  + RV              T   W  F  I+  T    V    +    L+   P  
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGTVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 402 PRATERKMTQIMFETFNTP 458
            RA   K+T++MFE +N P
Sbjct: 129 TRAKREKLTELMFEHYNIP 147



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P+++G V +WD  + I  HT+   ++     HPVL++EA  N +  REK
Sbjct: 87  PLKNGTVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREK 135


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 116,580,705
Number of Sequences: 237096
Number of extensions: 3076622
Number of successful extensions: 9799
Number of sequences better than 10.0: 294
Number of HSP's better than 10.0 without gapping: 8507
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9769
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6972732040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).