BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30173 (581 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118353-1|AAM48382.1| 488|Drosophila melanogaster RE01052p pro... 29 3.5 AY051482-1|AAK92906.1| 497|Drosophila melanogaster GH14349p pro... 29 3.5 AE014296-2840|AAF49390.3| 497|Drosophila melanogaster CG9665-PA... 29 3.5 >AY118353-1|AAM48382.1| 488|Drosophila melanogaster RE01052p protein. Length = 488 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -3 Query: 243 HARTCSSTTRSPGLCSPGFC*PGHCSRGLCSWYIC 139 H+ +CSS + S CS C CS CS C Sbjct: 391 HSNSCSSKSCSSNKCSSNKCSSNRCSSNKCSSNSC 425 >AY051482-1|AAK92906.1| 497|Drosophila melanogaster GH14349p protein. Length = 497 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 388 LVCYIILLRSPPQTPSGPPFDPPSLAHSFVGP 483 L Y +L R P P PFD PS + SF P Sbjct: 3 LAQYPVLPRGSPDDPLADPFDDPSYSFSFRTP 34 >AE014296-2840|AAF49390.3| 497|Drosophila melanogaster CG9665-PA protein. Length = 497 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 388 LVCYIILLRSPPQTPSGPPFDPPSLAHSFVGP 483 L Y +L R P P PFD PS + SF P Sbjct: 3 LAQYPVLPRGSPDDPLADPFDDPSYSFSFRTP 34 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,134,425 Number of Sequences: 53049 Number of extensions: 461490 Number of successful extensions: 1831 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1815 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2317436688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -