SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M98351-3|AAA99427.1|  363|Drosophila melanogaster fructose 1,6 b...   159   4e-39
M98351-2|AAA99426.1|  363|Drosophila melanogaster fructose 1,6 b...   159   4e-39
M98351-1|AAA99428.1|  361|Drosophila melanogaster fructose 1,6 b...   159   4e-39
D10762-1|BAA01592.1|  363|Drosophila melanogaster aldolase protein.   159   4e-39
D10446-3|BAA01238.1|  363|Drosophila melanogaster aldolase alpha...   159   4e-39
D10446-2|BAA01237.1|  363|Drosophila melanogaster aldolase beta ...   159   4e-39
D10446-1|BAA01236.1|  361|Drosophila melanogaster aldolase gamma...   159   4e-39
DQ864144-1|ABH06779.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864143-1|ABH06778.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864142-1|ABH06777.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864141-1|ABH06776.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864140-1|ABH06775.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864139-1|ABH06774.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864138-1|ABH06773.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864137-1|ABH06772.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864136-1|ABH06771.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864135-1|ABH06770.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864134-1|ABH06769.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
DQ864133-1|ABH06768.1|  423|Drosophila melanogaster aldolase pro...   159   4e-39
AY128452-1|AAM75045.1|  289|Drosophila melanogaster LP03138p pro...   159   4e-39
AY058667-1|AAL13896.1|  361|Drosophila melanogaster LD37852p pro...   159   4e-39
AE014297-3937|AAN14384.1|  363|Drosophila melanogaster CG6058-PE...   159   4e-39
AE014297-3936|AAN14383.2|  396|Drosophila melanogaster CG6058-PG...   159   4e-39
AE014297-3935|AAF56580.3|  396|Drosophila melanogaster CG6058-PA...   159   4e-39
AE014297-3934|AAS65220.1|  363|Drosophila melanogaster CG6058-PH...   159   4e-39
AE014297-3933|AAN14382.1|  361|Drosophila melanogaster CG6058-PD...   159   4e-39
AE014297-3932|AAN14381.1|  361|Drosophila melanogaster CG6058-PC...   159   4e-39
AE014297-3931|AAF56579.1|  361|Drosophila melanogaster CG6058-PB...   159   4e-39
AE014297-3930|AAN14380.1|  394|Drosophila melanogaster CG6058-PF...   159   4e-39
X60064-2|CAA42667.1|  361|Drosophila melanogaster fructose-bisph...   157   1e-38
X60064-1|CAA42666.1|  395|Drosophila melanogaster aldolase-relat...   157   1e-38
AE014297-3944|AAF56587.2|  364|Drosophila melanogaster CG5432-PA...   138   6e-33
L27654-1|AAA69925.1|  192|Drosophila melanogaster phosphoglycero...    35   0.16 
U25686-1|AAA83228.1| 1221|Drosophila melanogaster E93 protein.         32   1.1  
AE014298-2874|AAF48973.1| 1039|Drosophila melanogaster CG14217-P...    31   1.4  
AE014298-2873|AAN09504.1| 1039|Drosophila melanogaster CG14217-P...    31   1.4  
AB277547-1|BAF51959.1| 1039|Drosophila melanogaster serine/threo...    31   1.4  
AE014297-1814|AAN13598.1|  520|Drosophila melanogaster CG31326-P...    30   3.3  
AY118446-1|AAM48475.1|  208|Drosophila melanogaster SD17528p pro...    30   4.4  
AY118424-1|AAM48453.1|  208|Drosophila melanogaster RH06886p pro...    30   4.4  
AE014297-4463|AAN14192.1|  208|Drosophila melanogaster CG7808-PC...    30   4.4  
AY060689-1|AAL28237.1| 1952|Drosophila melanogaster GH12891p pro...    29   5.8  
AE014298-1331|AAF46494.1| 4547|Drosophila melanogaster CG12139-P...    29   5.8  
AY071703-1|AAL49325.1|  520|Drosophila melanogaster RH19136p pro...    29   7.7  
AE014297-3458|AAF56235.2|  144|Drosophila melanogaster CG18428-P...    29   7.7  

>M98351-3|AAA99427.1|  363|Drosophila melanogaster fructose 1,6
           bisphosphate-aldolase4A protein.
          Length = 363

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>M98351-2|AAA99426.1|  363|Drosophila melanogaster fructose 1,6
           bisphosphate-aldolase4C protein.
          Length = 363

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>M98351-1|AAA99428.1|  361|Drosophila melanogaster fructose 1,6
           bisphosphate-aldolase4B protein.
          Length = 361

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>D10762-1|BAA01592.1|  363|Drosophila melanogaster aldolase protein.
          Length = 363

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSERIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  107 bits (256), Expect = 2e-23
 Identities = 51/65 (78%), Positives = 57/65 (87%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  T GKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTHGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>D10446-3|BAA01238.1|  363|Drosophila melanogaster aldolase alpha
           protein.
          Length = 363

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSERIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  107 bits (256), Expect = 2e-23
 Identities = 51/65 (78%), Positives = 57/65 (87%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  T GKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTHGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>D10446-2|BAA01237.1|  363|Drosophila melanogaster aldolase beta
           protein.
          Length = 363

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSERIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  107 bits (256), Expect = 2e-23
 Identities = 51/65 (78%), Positives = 57/65 (87%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  T GKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTHGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>D10446-1|BAA01236.1|  361|Drosophila melanogaster aldolase gamma
           protein.
          Length = 361

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSERIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  107 bits (256), Expect = 2e-23
 Identities = 51/65 (78%), Positives = 57/65 (87%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  T GKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTHGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864144-1|ABH06779.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864143-1|ABH06778.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864142-1|ABH06777.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864141-1|ABH06776.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864140-1|ABH06775.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864139-1|ABH06774.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864138-1|ABH06773.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864137-1|ABH06772.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864136-1|ABH06771.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864135-1|ABH06770.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864134-1|ABH06769.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>DQ864133-1|ABH06768.1|  423|Drosophila melanogaster aldolase
           protein.
          Length = 423

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>AY128452-1|AAM75045.1|  289|Drosophila melanogaster LP03138p
           protein.
          Length = 289

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>AY058667-1|AAL13896.1|  361|Drosophila melanogaster LD37852p
           protein.
          Length = 361

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>AE014297-3937|AAN14384.1|  363|Drosophila melanogaster CG6058-PE,
           isoform E protein.
          Length = 363

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>AE014297-3936|AAN14383.2|  396|Drosophila melanogaster CG6058-PG,
           isoform G protein.
          Length = 396

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 100 DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 159

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 160 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 218

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 219 IVEPEV 224



 Score =  114 bits (275), Expect = 1e-25
 Identities = 56/83 (67%), Positives = 67/83 (80%)
 Frame = +3

Query: 6   TVLVFRVVINTRIKK*STMSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGK 185
           T+L ++ +I     + S M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGK
Sbjct: 16  TLLSYKNIIVENYTRISKMTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGK 75

Query: 186 RLQDIGVENTEENRRRYRQLLFS 254
           RLQDIGVENTE+NRR YRQLLFS
Sbjct: 76  RLQDIGVENTEDNRRAYRQLLFS 98


>AE014297-3935|AAF56580.3|  396|Drosophila melanogaster CG6058-PA,
           isoform A protein.
          Length = 396

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 100 DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 159

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 160 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 218

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 219 IVEPEV 224



 Score =  114 bits (275), Expect = 1e-25
 Identities = 56/83 (67%), Positives = 67/83 (80%)
 Frame = +3

Query: 6   TVLVFRVVINTRIKK*STMSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGK 185
           T+L ++ +I     + S M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGK
Sbjct: 16  TLLSYKNIIVENYTRISKMTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGK 75

Query: 186 RLQDIGVENTEENRRRYRQLLFS 254
           RLQDIGVENTE+NRR YRQLLFS
Sbjct: 76  RLQDIGVENTEDNRRAYRQLLFS 98


>AE014297-3934|AAS65220.1|  363|Drosophila melanogaster CG6058-PH,
           isoform H protein.
          Length = 363

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>AE014297-3933|AAN14382.1|  361|Drosophila melanogaster CG6058-PD,
           isoform D protein.
          Length = 361

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>AE014297-3932|AAN14381.1|  361|Drosophila melanogaster CG6058-PC,
           isoform C protein.
          Length = 361

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>AE014297-3931|AAF56579.1|  361|Drosophila melanogaster CG6058-PB,
           isoform B protein.
          Length = 361

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>AE014297-3930|AAN14380.1|  394|Drosophila melanogaster CG6058-PF,
           isoform F protein.
          Length = 394

 Score =  159 bits (386), Expect = 4e-39
 Identities = 79/126 (62%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVDKGVVPLFGSEDE TTQ
Sbjct: 100 DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQ 159

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 160 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 218

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 219 IVEPEV 224



 Score =  114 bits (275), Expect = 1e-25
 Identities = 56/83 (67%), Positives = 67/83 (80%)
 Frame = +3

Query: 6   TVLVFRVVINTRIKK*STMSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGK 185
           T+L ++ +I     + S M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGK
Sbjct: 16  TLLSYKNIIVENYTRISKMTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGK 75

Query: 186 RLQDIGVENTEENRRRYRQLLFS 254
           RLQDIGVENTE+NRR YRQLLFS
Sbjct: 76  RLQDIGVENTEDNRRAYRQLLFS 98


>X60064-2|CAA42667.1|  361|Drosophila melanogaster
           fructose-bisphosphate aldolase protein.
          Length = 361

 Score =  157 bits (382), Expect = 1e-38
 Identities = 78/126 (61%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVD+GVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDEGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>X60064-1|CAA42666.1|  395|Drosophila melanogaster aldolase-related
           protein protein.
          Length = 395

 Score =  157 bits (382), Expect = 1e-38
 Identities = 78/126 (61%), Positives = 90/126 (71%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  L+ENISGVILFHETLYQKADDGTP   +L+KKGII GIKVD+GVVPLFGSEDE TTQ
Sbjct: 67  DPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDEGVVPLFGSEDEVTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKKDGC FAKWRC  +     P  +   +    LAR    + +      
Sbjct: 127 GLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYA-SICQSQRIVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score =  109 bits (263), Expect = 3e-24
 Identities = 52/65 (80%), Positives = 58/65 (89%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+TYF YP+ ELQ+EL++IAQ IVAP KGILAADES  TMGKRLQDIGVENTE+NRR YR
Sbjct: 1   MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR 60

Query: 240 QLLFS 254
           QLLFS
Sbjct: 61  QLLFS 65


>AE014297-3944|AAF56587.2|  364|Drosophila melanogaster CG5432-PA
           protein.
          Length = 364

 Score =  138 bits (335), Expect = 6e-33
 Identities = 67/126 (53%), Positives = 82/126 (65%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  ++ENISGVI +HETL+Q+ DDG P V  L KKGI+ GIKVDK   PLFGSEDE TTQ
Sbjct: 67  DPKIAENISGVIFYHETLHQRTDDGLPFVEALRKKGILTGIKVDKHFSPLFGSEDEFTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLDDLA RCAQYKK+GC FAKWRC  +     P  +   +    +AR    + +      
Sbjct: 127 GLDDLANRCAQYKKEGCSFAKWRCILKITKNTPSPQAILENANVMARYA-AICQSQRLVP 185

Query: 617 LLKPEV 634
           ++ PEV
Sbjct: 186 IISPEV 191



 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 46/65 (70%), Positives = 54/65 (83%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+T+F YP  ELQEEL  I++A+VAP KGILAADES+  MGKR Q IGVENTEENRR YR
Sbjct: 1   MTTHFYYPNKELQEELICISKALVAPGKGILAADESSAVMGKRFQLIGVENTEENRRLYR 60

Query: 240 QLLFS 254
           Q+LF+
Sbjct: 61  QMLFT 65


>L27654-1|AAA69925.1|  192|Drosophila melanogaster
           phosphoglyceromutase protein.
          Length = 192

 Score = 34.7 bits (76), Expect = 0.16
 Identities = 19/34 (55%), Positives = 21/34 (61%)
 Frame = +1

Query: 355 EEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRP 456
           E+G   R QGRQGCRP VR G    H G+  PRP
Sbjct: 25  EKGGSSRAQGRQGCRPGVRCG---PHLGA-NPRP 54


>U25686-1|AAA83228.1| 1221|Drosophila melanogaster E93 protein.
          Length = 1221

 Score = 31.9 bits (69), Expect = 1.1
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = -3

Query: 582  RKRARNIGVFLDSLVRGGVAADLQQQRHLAKWQPSFLYWAQRWARSSR-PW 433
            R+R  +I V LD+  R        + R  +KW   F YW+ RW R  R PW
Sbjct: 1128 RRRPPDITV-LDTTPRPYCTRSWSRSRP-SKWTRRFSYWSSRWTRIQRSPW 1176


>AE014298-2874|AAF48973.1| 1039|Drosophila melanogaster CG14217-PE,
           isoform E protein.
          Length = 1039

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 5/102 (4%)
 Frame = +1

Query: 331 NASGLPAGEEGHH--PRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEGR-LPLRQV 501
           +++ +PA  + HH    H  +Q    AV      HH    +P P+    Q+G+ +P   V
Sbjct: 367 SSNSIPAAAQNHHHIAAHHHQQAASAAVAAAMHHHHHPHQQPPPSWPSGQQGQPVPPGAV 426

Query: 502 ALLLKIGRNTPSYQAIQE--NANVSRPLTLPSVRANAFVPIV 621
           +      RN P    I    N NV+   +   V A A  P++
Sbjct: 427 SRNSSRHRNRPPLPNIMHSMNNNVTPTNSASVVPAPAPAPVL 468


>AE014298-2873|AAN09504.1| 1039|Drosophila melanogaster CG14217-PD,
           isoform D protein.
          Length = 1039

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 5/102 (4%)
 Frame = +1

Query: 331 NASGLPAGEEGHH--PRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEGR-LPLRQV 501
           +++ +PA  + HH    H  +Q    AV      HH    +P P+    Q+G+ +P   V
Sbjct: 367 SSNSIPAAAQNHHHIAAHHHQQAASAAVAAAMHHHHHPHQQPPPSWPSGQQGQPVPPGAV 426

Query: 502 ALLLKIGRNTPSYQAIQE--NANVSRPLTLPSVRANAFVPIV 621
           +      RN P    I    N NV+   +   V A A  P++
Sbjct: 427 SRNSSRHRNRPPLPNIMHSMNNNVTPTNSASVVPAPAPAPVL 468


>AB277547-1|BAF51959.1| 1039|Drosophila melanogaster
           serine/threonine protein kinaseTAO1 alpha protein.
          Length = 1039

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 5/102 (4%)
 Frame = +1

Query: 331 NASGLPAGEEGHH--PRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEGR-LPLRQV 501
           +++ +PA  + HH    H  +Q    AV      HH    +P P+    Q+G+ +P   V
Sbjct: 367 SSNSIPAAAQNHHHIAAHHHQQAASAAVAAAMHHHHHPHQQPPPSWPSGQQGQPVPPGAV 426

Query: 502 ALLLKIGRNTPSYQAIQE--NANVSRPLTLPSVRANAFVPIV 621
           +      RN P    I    N NV+   +   V A A  P++
Sbjct: 427 SRNSSRHRNRPPLPNIMHSMNNNVTPTNSASVVPAPAPAPVL 468


>AE014297-1814|AAN13598.1|  520|Drosophila melanogaster CG31326-PA
           protein.
          Length = 520

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +2

Query: 590 LSEPTHSCRLLKPEVFT*WAKHEPWNR 670
           ++E  ++C L KP VFT  AKH  W R
Sbjct: 489 INEKENTCELSKPSVFTDVAKHIEWVR 515


>AY118446-1|AAM48475.1|  208|Drosophila melanogaster SD17528p
           protein.
          Length = 208

 Score = 29.9 bits (64), Expect = 4.4
 Identities = 22/66 (33%), Positives = 30/66 (45%)
 Frame = -1

Query: 755 GGKNLVVRLRGLFKTGRPRTTFKLTFLGRGSKVRASPIR*RLRASTIGTNALALTDGSVS 576
           GGK   +R +  F+ GRP    KL   GR  KVR      +LRA  + T   A     V+
Sbjct: 15  GGKRKSLRKKRKFELGRPAANTKLG-SGRVHKVRTRGGNTKLRALRLETGNFAWASEGVA 73

Query: 575 GRETLA 558
            +  +A
Sbjct: 74  RKTRIA 79


>AY118424-1|AAM48453.1|  208|Drosophila melanogaster RH06886p
           protein.
          Length = 208

 Score = 29.9 bits (64), Expect = 4.4
 Identities = 22/66 (33%), Positives = 30/66 (45%)
 Frame = -1

Query: 755 GGKNLVVRLRGLFKTGRPRTTFKLTFLGRGSKVRASPIR*RLRASTIGTNALALTDGSVS 576
           GGK   +R +  F+ GRP    KL   GR  KVR      +LRA  + T   A     V+
Sbjct: 15  GGKRKSLRKKRKFELGRPAANTKLG-SGRVHKVRTRGGNTKLRALRLETGNFAWASEGVA 73

Query: 575 GRETLA 558
            +  +A
Sbjct: 74  RKTRIA 79


>AE014297-4463|AAN14192.1|  208|Drosophila melanogaster CG7808-PC
           protein.
          Length = 208

 Score = 29.9 bits (64), Expect = 4.4
 Identities = 22/66 (33%), Positives = 30/66 (45%)
 Frame = -1

Query: 755 GGKNLVVRLRGLFKTGRPRTTFKLTFLGRGSKVRASPIR*RLRASTIGTNALALTDGSVS 576
           GGK   +R +  F+ GRP    KL   GR  KVR      +LRA  + T   A     V+
Sbjct: 15  GGKRKSLRKKRKFELGRPAANTKLG-SGRVHKVRTRGGNTKLRALRLETGNFAWASEGVA 73

Query: 575 GRETLA 558
            +  +A
Sbjct: 74  RKTRIA 79


>AY060689-1|AAL28237.1| 1952|Drosophila melanogaster GH12891p
           protein.
          Length = 1952

 Score = 29.5 bits (63), Expect = 5.8
 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%)
 Frame = -3

Query: 240 GDNDDGSPL-CSPRRCPANAF 181
           GDN D  PL C  R CP N+F
Sbjct: 160 GDNSDEDPLHCGQRTCPTNSF 180


>AE014298-1331|AAF46494.1| 4547|Drosophila melanogaster CG12139-PB
            protein.
          Length = 4547

 Score = 29.5 bits (63), Expect = 5.8
 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%)
 Frame = -3

Query: 240  GDNDDGSPL-CSPRRCPANAF 181
            GDN D  PL C  R CP N+F
Sbjct: 2755 GDNSDEDPLHCGQRTCPTNSF 2775


>AY071703-1|AAL49325.1|  520|Drosophila melanogaster RH19136p
           protein.
          Length = 520

 Score = 29.1 bits (62), Expect = 7.7
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 590 LSEPTHSCRLLKPEVFT*WAKHEPWNR 670
           ++E  ++C L KP VFT  +KH  W R
Sbjct: 489 INEKENTCELSKPSVFTDVSKHIEWVR 515


>AE014297-3458|AAF56235.2|  144|Drosophila melanogaster CG18428-PA
           protein.
          Length = 144

 Score = 29.1 bits (62), Expect = 7.7
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = +2

Query: 122 SNCSSRKGYPRR*RIHRYNGKAFAGHRRGEHRGE-PSSLSPTPIQPDAVLSE 274
           S   S+K +  + R H+   K+    +    + E P   SPTPIQP+ V  E
Sbjct: 4   SEKKSKKKHKEKRREHKEKHKSKKSKKHNRKKEESPPIASPTPIQPERVNQE 55


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,352,397
Number of Sequences: 53049
Number of extensions: 1013408
Number of successful extensions: 3058
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 2742
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2990
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3901127880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).