SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT015283-1|AAT94512.1|  341|Drosophila melanogaster GH23746p pro...   111   1e-24
AE014296-2544|AAN11776.1|  317|Drosophila melanogaster CG7656-PA...   111   1e-24
AE014296-2542|AAF49611.1|  341|Drosophila melanogaster CG7656-PC...   111   1e-24
BT011473-1|AAR99131.1|  319|Drosophila melanogaster RE15288p pro...   108   1e-23
BT001441-1|AAN71196.1|  180|Drosophila melanogaster GH25305p pro...    57   3e-08
AE014297-1752|AAF54982.1|  168|Drosophila melanogaster CG9602-PA...    55   1e-07
AY051915-1|AAK93339.1|  270|Drosophila melanogaster LD40324p pro...    54   2e-07
AE014296-2543|AAN11777.2|  269|Drosophila melanogaster CG7656-PB...    54   2e-07
AY071574-1|AAL49196.1|  168|Drosophila melanogaster RE63412p pro...    54   3e-07
AE014296-3785|EAA46069.1|  168|Drosophila melanogaster CG40045-P...    54   3e-07
AY071319-1|AAL48941.1|  167|Drosophila melanogaster RE34144p pro...    49   7e-06
AJ277746-1|CAB90824.1|  200|Drosophila melanogaster ubiquitin co...    49   7e-06
AE014298-2427|AAF48626.1|  167|Drosophila melanogaster CG4443-PA...    49   7e-06
AE014296-686|AAF47786.2|  354|Drosophila melanogaster CG10862-PA...    37   0.028
X62575-1|CAA44453.1|  147|Drosophila melanogaster ubiquitin-conj...    36   0.086
AY060304-1|AAL25343.1|  147|Drosophila melanogaster GH14739p pro...    36   0.086
AE014297-1892|AAF55093.1|  147|Drosophila melanogaster CG7425-PA...    36   0.086
AE014134-238|AAF51384.1|  164|Drosophila melanogaster CG5440-PA ...    33   0.60 
AE014297-621|AAF54011.1|  153|Drosophila melanogaster CG12799-PA...    32   1.1  
X92663-1|CAA63351.1|  232|Drosophila melanogaster ubiquitin-conj...    30   3.2  
AY094899-1|AAM11252.1|  232|Drosophila melanogaster RE74673p pro...    30   3.2  
AY089444-1|AAL90182.1|  180|Drosophila melanogaster AT26201p pro...    30   3.2  
AE014296-918|AAF47953.1|  180|Drosophila melanogaster CG17030-PA...    30   3.2  
AE014134-1951|AAN10762.1|  232|Drosophila melanogaster CG6720-PB...    30   3.2  
AE014134-1950|AAF53008.1|  232|Drosophila melanogaster CG6720-PA...    30   3.2  
AY070806-1|AAL48428.1|  154|Drosophila melanogaster AT19555p pro...    30   4.3  
AE013599-1165|AAF58759.2|  139|Drosophila melanogaster CG7220-PB...    30   4.3  
AE013599-1164|AAS64867.1|  154|Drosophila melanogaster CG7220-PD...    30   4.3  
AE013599-1163|AAM68747.2|  154|Drosophila melanogaster CG7220-PC...    30   4.3  
AE013599-1162|AAM68746.2|  154|Drosophila melanogaster CG7220-PA...    30   4.3  
U51051-1|AAB01150.1|  153|Drosophila melanogaster ubiquitin conj...    29   7.4  
BT012459-1|AAS93730.1|  154|Drosophila melanogaster RE47264p pro...    29   7.4  
AY113332-1|AAM29337.1|  239|Drosophila melanogaster AT30415p pro...    29   7.4  
AL035311-4|CAA22948.1|  154|Drosophila melanogaster EG:52C10.4 p...    29   7.4  
AJ238007-1|CAB40790.1|  154|Drosophila melanogaster ubiquitin-co...    29   7.4  
AE014298-1762|AAF48159.2|  239|Drosophila melanogaster CG2574-PA...    29   7.4  
AE013599-2566|AAF57787.1|  154|Drosophila melanogaster CG5788-PA...    29   7.4  
BT010015-1|AAQ22484.1|  283|Drosophila melanogaster RE16955p pro...    29   9.8  
BT001556-1|AAN71311.1|  504|Drosophila melanogaster RE12395p pro...    29   9.8  
BT001503-1|AAN71258.1|  504|Drosophila melanogaster LD35207p pro...    29   9.8  
AY061029-1|AAL28577.1|  283|Drosophila melanogaster HL05730p pro...    29   9.8  
AE014297-2362|AAF55427.2|  283|Drosophila melanogaster CG5823-PA...    29   9.8  
AE013599-397|AAS64903.1|  504|Drosophila melanogaster CG11166-PG...    29   9.8  
AE013599-396|AAS64902.1|  504|Drosophila melanogaster CG11166-PF...    29   9.8  
AE013599-395|AAM68890.1|  504|Drosophila melanogaster CG11166-PE...    29   9.8  
AE013599-394|AAM68889.1|  504|Drosophila melanogaster CG11166-PD...    29   9.8  
AE013599-393|AAM68888.1|  504|Drosophila melanogaster CG11166-PC...    29   9.8  
AE013599-392|AAF59263.2|  504|Drosophila melanogaster CG11166-PA...    29   9.8  

>BT015283-1|AAT94512.1|  341|Drosophila melanogaster GH23746p
           protein.
          Length = 341

 Score =  111 bits (266), Expect = 1e-24
 Identities = 61/116 (52%), Positives = 69/116 (59%), Gaps = 1/116 (0%)
 Frame = +2

Query: 353 TVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT* 532
           T P+SSA+RALA+EYKSLQEEPVEGFRVKL+ +DNLFEWEVAIFGPPDTLYQ    +   
Sbjct: 57  TTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHM 116

Query: 533 NSPLTTRIHHHPLGFLTKVWASKCI*K-RRSLHIDSPPARGMILSLANCPCERWEP 697
             P         + FLTKVW           + I  PP           PCERW P
Sbjct: 117 KFPHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDP--QSGELPCERWNP 170


>AE014296-2544|AAN11776.1|  317|Drosophila melanogaster CG7656-PA,
           isoform A protein.
          Length = 317

 Score =  111 bits (266), Expect = 1e-24
 Identities = 61/116 (52%), Positives = 69/116 (59%), Gaps = 1/116 (0%)
 Frame = +2

Query: 353 TVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT* 532
           T P+SSA+RALA+EYKSLQEEPVEGFRVKL+ +DNLFEWEVAIFGPPDTLYQ    +   
Sbjct: 35  TTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHM 94

Query: 533 NSPLTTRIHHHPLGFLTKVWASKCI*K-RRSLHIDSPPARGMILSLANCPCERWEP 697
             P         + FLTKVW           + I  PP           PCERW P
Sbjct: 95  KFPHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDP--QSGELPCERWNP 148


>AE014296-2542|AAF49611.1|  341|Drosophila melanogaster CG7656-PC,
           isoform C protein.
          Length = 341

 Score =  111 bits (266), Expect = 1e-24
 Identities = 61/116 (52%), Positives = 69/116 (59%), Gaps = 1/116 (0%)
 Frame = +2

Query: 353 TVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT* 532
           T P+SSA+RALA+EYKSLQEEPVEGFRVKL+ +DNLFEWEVAIFGPPDTLYQ    +   
Sbjct: 57  TTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHM 116

Query: 533 NSPLTTRIHHHPLGFLTKVWASKCI*K-RRSLHIDSPPARGMILSLANCPCERWEP 697
             P         + FLTKVW           + I  PP           PCERW P
Sbjct: 117 KFPHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDP--QSGELPCERWNP 170


>BT011473-1|AAR99131.1|  319|Drosophila melanogaster RE15288p
           protein.
          Length = 319

 Score =  108 bits (259), Expect = 1e-23
 Identities = 60/116 (51%), Positives = 68/116 (58%), Gaps = 1/116 (0%)
 Frame = +2

Query: 353 TVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT* 532
           T P+SSA+RALA+EYKSLQE PVEGFRVKL+ +DNLFEWEVAIFGPPDTLYQ    +   
Sbjct: 35  TTPSSSAVRALAMEYKSLQEGPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHM 94

Query: 533 NSPLTTRIHHHPLGFLTKVWASKCI*K-RRSLHIDSPPARGMILSLANCPCERWEP 697
             P         + FLTKVW           + I  PP           PCERW P
Sbjct: 95  KFPHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDP--QSGELPCERWNP 148


>BT001441-1|AAN71196.1|  180|Drosophila melanogaster GH25305p
           protein.
          Length = 180

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 5/86 (5%)
 Frame = +2

Query: 350 NTVPTS--SALRALAL---EYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVD 514
           N +P+S  S L+A  L   +   LQ  PVEGF   L+ + ++F+WEV I GPPDTLY+  
Sbjct: 6   NKIPSSDMSELQASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGG 65

Query: 515 TSRHT*NSPLTTRIHHHPLGFLTKVW 592
             +     P    +    + F+T++W
Sbjct: 66  FFKAHLIFPKEYPLRPPKMKFITEIW 91



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 12/18 (66%), Positives = 15/18 (83%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+ + GD+CISILH P
Sbjct: 92  HPNIDKAGDVCISILHEP 109


>AE014297-1752|AAF54982.1|  168|Drosophila melanogaster CG9602-PA
           protein.
          Length = 168

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 24/67 (35%), Positives = 37/67 (55%)
 Frame = +2

Query: 392 EYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHHHPL 571
           +   LQ  PVEGF   L+ + ++F+WEV I GPPDTLY+    +     P    +    +
Sbjct: 13  QLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKM 72

Query: 572 GFLTKVW 592
            F+T++W
Sbjct: 73  KFITEIW 79



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 12/18 (66%), Positives = 15/18 (83%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+ + GD+CISILH P
Sbjct: 80  HPNIDKAGDVCISILHEP 97


>AY051915-1|AAK93339.1|  270|Drosophila melanogaster LD40324p
           protein.
          Length = 270

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 28/46 (60%), Positives = 29/46 (63%)
 Frame = +3

Query: 576 F*LKSGHPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVR 713
           F  K  HPNVYENGDLCISILHPPV         P    NPTQ+VR
Sbjct: 62  FLTKVWHPNVYENGDLCISILHPPVD-DPQSGELPCERWNPTQNVR 106



 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 41/107 (38%), Positives = 48/107 (44%), Gaps = 7/107 (6%)
 Frame = +1

Query: 469 GSGNLRTAGY------TLSSGYFKA-HMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFA 627
           GSG+L T+        T SS   +A  MKFP DYPYSPPSIR         +Y   ++  
Sbjct: 20  GSGSLATSSSAAAPTTTPSSSAVRALAMKFPHDYPYSPPSIRFLTKVWHPNVYENGDL-C 78

Query: 628 YRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNTF 768
                 P DDPQSGELP        N     T  L +      PNTF
Sbjct: 79  ISILHPPVDDPQSGELPCERWNPTQN---VRTILLSVISLLNEPNTF 122


>AE014296-2543|AAN11777.2|  269|Drosophila melanogaster CG7656-PB,
           isoform B protein.
          Length = 269

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 28/46 (60%), Positives = 29/46 (63%)
 Frame = +3

Query: 576 F*LKSGHPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVR 713
           F  K  HPNVYENGDLCISILHPPV         P    NPTQ+VR
Sbjct: 61  FLTKVWHPNVYENGDLCISILHPPVD-DPQSGELPCERWNPTQNVR 105



 Score = 48.8 bits (111), Expect = 9e-06
 Identities = 39/106 (36%), Positives = 46/106 (43%), Gaps = 6/106 (5%)
 Frame = +1

Query: 469 GSGNLRTAGY------TLSSGYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAY 630
           GSG+L T+        T SS   +A   FP DYPYSPPSIR         +Y   ++   
Sbjct: 20  GSGSLATSSSAAAPTTTPSSSAVRALAMFPHDYPYSPPSIRFLTKVWHPNVYENGDL-CI 78

Query: 631 RFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNTF 768
                P DDPQSGELP        N     T  L +      PNTF
Sbjct: 79  SILHPPVDDPQSGELPCERWNPTQN---VRTILLSVISLLNEPNTF 121


>AY071574-1|AAL49196.1|  168|Drosophila melanogaster RE63412p
           protein.
          Length = 168

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 25/70 (35%), Positives = 38/70 (54%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  +   L + PVEGF   L+ E+++F WEV I GPPDTLY+    +     P    +  
Sbjct: 10  LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRP 69

Query: 563 HPLGFLTKVW 592
             + F+T++W
Sbjct: 70  PRMKFVTEIW 79



 Score = 36.7 bits (81), Expect = 0.037
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+ +NGD+CISILH P
Sbjct: 80  HPNIEKNGDVCISILHEP 97


>AE014296-3785|EAA46069.1|  168|Drosophila melanogaster CG40045-PA
           protein.
          Length = 168

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 25/70 (35%), Positives = 38/70 (54%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  +   L + PVEGF   L+ E+++F WEV I GPPDTLY+    +     P    +  
Sbjct: 10  LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRP 69

Query: 563 HPLGFLTKVW 592
             + F+T++W
Sbjct: 70  PRMKFVTEIW 79



 Score = 36.7 bits (81), Expect = 0.037
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPN+ +NGD+CISILH P
Sbjct: 80  HPNIEKNGDVCISILHEP 97


>AY071319-1|AAL48941.1|  167|Drosophila melanogaster RE34144p
           protein.
          Length = 167

 Score = 49.2 bits (112), Expect = 7e-06
 Identities = 23/47 (48%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           SALR L  EYK L  +P EG     + EDN FEWE  I GP  T ++
Sbjct: 4   SALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFE 50



 Score = 34.3 bits (75), Expect = 0.20
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN++ +G +CISILH P G   +     A   +P QSV
Sbjct: 79  HPNIFADGRVCISILHAP-GDDPMGYELSAERWSPVQSV 116



 Score = 31.5 bits (68), Expect = 1.4
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           G     G F A + FP DYP SPP ++
Sbjct: 46  GTCFEGGVFPARLIFPTDYPLSPPKMK 72


>AJ277746-1|CAB90824.1|  200|Drosophila melanogaster ubiquitin
           conjugating enzyme protein.
          Length = 200

 Score = 49.2 bits (112), Expect = 7e-06
 Identities = 23/47 (48%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           SALR L  EYK L  +P EG     + EDN FEWE  I GP  T ++
Sbjct: 4   SALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFE 50



 Score = 34.3 bits (75), Expect = 0.20
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN++ +G +CISILH P G   +     A   +P QSV
Sbjct: 79  HPNIFADGRVCISILHAP-GDDPMGYELSAERWSPVQSV 116



 Score = 31.5 bits (68), Expect = 1.4
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           G     G F A + FP DYP SPP ++
Sbjct: 46  GTCFEGGVFPARLIFPTDYPLSPPKMK 72


>AE014298-2427|AAF48626.1|  167|Drosophila melanogaster CG4443-PA
           protein.
          Length = 167

 Score = 49.2 bits (112), Expect = 7e-06
 Identities = 23/47 (48%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           SALR L  EYK L  +P EG     + EDN FEWE  I GP  T ++
Sbjct: 4   SALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFE 50



 Score = 34.3 bits (75), Expect = 0.20
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN++ +G +CISILH P G   +     A   +P QSV
Sbjct: 79  HPNIFADGRVCISILHAP-GDDPMGYELSAERWSPVQSV 116



 Score = 31.5 bits (68), Expect = 1.4
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           G     G F A + FP DYP SPP ++
Sbjct: 46  GTCFEGGVFPARLIFPTDYPLSPPKMK 72


>AE014296-686|AAF47786.2|  354|Drosophila melanogaster CG10862-PA
           protein.
          Length = 354

 Score = 37.1 bits (82), Expect = 0.028
 Identities = 22/70 (31%), Positives = 32/70 (45%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  E      +  EG + +++G DNLF W   I GP +T+Y+    R     P     + 
Sbjct: 213 LRREISEFSTDQTEGCKAEMVG-DNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYP 271

Query: 563 HPLGFLTKVW 592
             L FLTK +
Sbjct: 272 PYLAFLTKTY 281


>X62575-1|CAA44453.1|  147|Drosophila melanogaster
           ubiquitin-conjugating  enzyme protein.
          Length = 147

 Score = 35.5 bits (78), Expect = 0.086
 Identities = 21/74 (28%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E + L  +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRINKELQDLGRDPPAQCSAGPVGDD-LFHWQATIMGPPDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>AY060304-1|AAL25343.1|  147|Drosophila melanogaster GH14739p
           protein.
          Length = 147

 Score = 35.5 bits (78), Expect = 0.086
 Identities = 21/74 (28%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E + L  +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRINKELQDLGRDPPAQCSAGPVGDD-LFHWQATIMGPPDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>AE014297-1892|AAF55093.1|  147|Drosophila melanogaster CG7425-PA
           protein.
          Length = 147

 Score = 35.5 bits (78), Expect = 0.086
 Identities = 21/74 (28%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E + L  +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRINKELQDLGRDPPAQCSAGPVGDD-LFHWQATIMGPPDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>AE014134-238|AAF51384.1|  164|Drosophila melanogaster CG5440-PA
           protein.
          Length = 164

 Score = 32.7 bits (71), Expect = 0.60
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           ++SA++ +  E   +  +P + +      EDNL+EW   I GP D++Y+
Sbjct: 19  SNSAVKRIQKELDEITRDPPQ-YCSAGPKEDNLYEWTSTIIGPADSVYE 66


>AE014297-621|AAF54011.1|  153|Drosophila melanogaster CG12799-PA
           protein.
          Length = 153

 Score = 31.9 bits (69), Expect = 1.1
 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 1/68 (1%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGELPLR 684
           + G F+  + FPP YP+ PP I          +  K E+     ST  W      E  L+
Sbjct: 47  NKGAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQ 106

Query: 685 TL-GTLHN 705
            L   +HN
Sbjct: 107 ALVAIVHN 114


>X92663-1|CAA63351.1|  232|Drosophila melanogaster
           ubiquitin-conjugating enzyme UbcD2 protein.
          Length = 232

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +2

Query: 452 DNLFEWEVAIFGPPDTLYQ 508
           DNL+EW   I GPP ++Y+
Sbjct: 113 DNLYEWVSTILGPPGSVYE 131


>AY094899-1|AAM11252.1|  232|Drosophila melanogaster RE74673p
           protein.
          Length = 232

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +2

Query: 452 DNLFEWEVAIFGPPDTLYQ 508
           DNL+EW   I GPP ++Y+
Sbjct: 113 DNLYEWVSTILGPPGSVYE 131


>AY089444-1|AAL90182.1|  180|Drosophila melanogaster AT26201p
           protein.
          Length = 180

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = +1

Query: 472 SGNLRTAGYTLSSGYFKAHMKFPPDYPYSPPSIRV 576
           +G L         G +K  + FP DYP+ PP I +
Sbjct: 45  TGLLMPVAPPYDKGAYKMEIDFPLDYPFKPPRIHI 79


>AE014296-918|AAF47953.1|  180|Drosophila melanogaster CG17030-PA
           protein.
          Length = 180

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = +1

Query: 472 SGNLRTAGYTLSSGYFKAHMKFPPDYPYSPPSIRV 576
           +G L         G +K  + FP DYP+ PP I +
Sbjct: 45  TGLLMPVAPPYDKGAYKMEIDFPLDYPFKPPRIHI 79


>AE014134-1951|AAN10762.1|  232|Drosophila melanogaster CG6720-PB,
           isoform B protein.
          Length = 232

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +2

Query: 452 DNLFEWEVAIFGPPDTLYQ 508
           DNL+EW   I GPP ++Y+
Sbjct: 113 DNLYEWVSTILGPPGSVYE 131


>AE014134-1950|AAF53008.1|  232|Drosophila melanogaster CG6720-PA,
           isoform A protein.
          Length = 232

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +2

Query: 452 DNLFEWEVAIFGPPDTLYQ 508
           DNL+EW   I GPP ++Y+
Sbjct: 113 DNLYEWVSTILGPPGSVYE 131


>AY070806-1|AAL48428.1|  154|Drosophila melanogaster AT19555p
           protein.
          Length = 154

 Score = 29.9 bits (64), Expect = 4.3
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVRNRYSPSGN 737
           HP+VY NG +C+SIL      +   ++   ++ +   S R +  P  N
Sbjct: 84  HPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDN 131



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLG-EDNLFEWEVAIFGPPDTLYQ 508
           S + R L  E  SL +EP  G  +     + NL EW++ I G   TLY+
Sbjct: 5   SPSERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYE 53


>AE013599-1165|AAF58759.2|  139|Drosophila melanogaster CG7220-PB,
           isoform B protein.
          Length = 139

 Score = 29.9 bits (64), Expect = 4.3
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVRNRYSPSGN 737
           HP+VY NG +C+SIL      +   ++   ++ +   S R +  P  N
Sbjct: 69  HPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDN 116


>AE013599-1164|AAS64867.1|  154|Drosophila melanogaster CG7220-PD,
           isoform D protein.
          Length = 154

 Score = 29.9 bits (64), Expect = 4.3
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVRNRYSPSGN 737
           HP+VY NG +C+SIL      +   ++   ++ +   S R +  P  N
Sbjct: 84  HPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDN 131



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLG-EDNLFEWEVAIFGPPDTLYQ 508
           S + R L  E  SL +EP  G  +     + NL EW++ I G   TLY+
Sbjct: 5   SPSERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYE 53


>AE013599-1163|AAM68747.2|  154|Drosophila melanogaster CG7220-PC,
           isoform C protein.
          Length = 154

 Score = 29.9 bits (64), Expect = 4.3
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVRNRYSPSGN 737
           HP+VY NG +C+SIL      +   ++   ++ +   S R +  P  N
Sbjct: 84  HPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDN 131



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLG-EDNLFEWEVAIFGPPDTLYQ 508
           S + R L  E  SL +EP  G  +     + NL EW++ I G   TLY+
Sbjct: 5   SPSERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYE 53


>AE013599-1162|AAM68746.2|  154|Drosophila melanogaster CG7220-PA,
           isoform A protein.
          Length = 154

 Score = 29.9 bits (64), Expect = 4.3
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVRNRYSPSGN 737
           HP+VY NG +C+SIL      +   ++   ++ +   S R +  P  N
Sbjct: 84  HPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDN 131



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLG-EDNLFEWEVAIFGPPDTLYQ 508
           S + R L  E  SL +EP  G  +     + NL EW++ I G   TLY+
Sbjct: 5   SPSERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYE 53


>U51051-1|AAB01150.1|  153|Drosophila melanogaster ubiquitin
           conjugating enzyme protein.
          Length = 153

 Score = 29.1 bits (62), Expect = 7.4
 Identities = 19/68 (27%), Positives = 27/68 (39%), Gaps = 1/68 (1%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGELPLR 684
           + G  +  + FPP YP+ PP I          +  K E+     ST  W      E  L+
Sbjct: 47  NKGAXRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQ 106

Query: 685 TL-GTLHN 705
            L   +HN
Sbjct: 107 ALVAIVHN 114


>BT012459-1|AAS93730.1|  154|Drosophila melanogaster RE47264p
           protein.
          Length = 154

 Score = 29.1 bits (62), Expect = 7.4
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F+  + FP +YP+ PP I
Sbjct: 47  NKGAFRIEINFPAEYPFKPPKI 68


>AY113332-1|AAM29337.1|  239|Drosophila melanogaster AT30415p
           protein.
          Length = 239

 Score = 29.1 bits (62), Expect = 7.4
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           G     G+F+  ++FP  YP+  P IR
Sbjct: 103 GSVYEGGHFRLDIRFPASYPFRAPRIR 129


>AL035311-4|CAA22948.1|  154|Drosophila melanogaster EG:52C10.4
           protein.
          Length = 154

 Score = 29.1 bits (62), Expect = 7.4
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F+  + FP +YP+ PP I
Sbjct: 47  NKGAFRIEINFPAEYPFKPPKI 68


>AJ238007-1|CAB40790.1|  154|Drosophila melanogaster
           ubiquitin-conjugating enzyme protein.
          Length = 154

 Score = 29.1 bits (62), Expect = 7.4
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F+  + FP +YP+ PP I
Sbjct: 47  NKGAFRIEINFPAEYPFKPPKI 68


>AE014298-1762|AAF48159.2|  239|Drosophila melanogaster CG2574-PA
           protein.
          Length = 239

 Score = 29.1 bits (62), Expect = 7.4
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           G     G+F+  ++FP  YP+  P IR
Sbjct: 103 GSVYEGGHFRLDIRFPASYPFRAPRIR 129


>AE013599-2566|AAF57787.1|  154|Drosophila melanogaster CG5788-PA
           protein.
          Length = 154

 Score = 29.1 bits (62), Expect = 7.4
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F+  + FP +YP+ PP I
Sbjct: 47  NKGAFRIEINFPAEYPFKPPKI 68


>BT010015-1|AAQ22484.1|  283|Drosophila melanogaster RE16955p
           protein.
          Length = 283

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSI 570
           GY+   + FP ++P+ PPSI
Sbjct: 61  GYYHGTLLFPREFPFKPPSI 80


>BT001556-1|AAN71311.1|  504|Drosophila melanogaster RE12395p
           protein.
          Length = 504

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 1/107 (0%)
 Frame = +1

Query: 448 RGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDY-PYSPPSIRVFN*SLGIQMYMKTEIF 624
           R  S+ VGS N  T     S      H  +  +   Y+   + +++   G     K    
Sbjct: 54  RMASVDVGSNNQVTVTVPNSESSGVPHTVYKGNQREYAKECLMIYDKETGAITIEKLNHN 113

Query: 625 AYRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNT 765
                TR     +S +LP + +G  HN+ A G  P+ + +P +   T
Sbjct: 114 IQVKKTRNEVTNKSVQLPGQNMGQPHNQGANGAAPVAVPVPGQGSGT 160


>BT001503-1|AAN71258.1|  504|Drosophila melanogaster LD35207p
           protein.
          Length = 504

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 1/107 (0%)
 Frame = +1

Query: 448 RGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDY-PYSPPSIRVFN*SLGIQMYMKTEIF 624
           R  S+ VGS N  T     S      H  +  +   Y+   + +++   G     K    
Sbjct: 54  RMASVDVGSNNQVTVTVPNSESSGVPHTVYKGNQREYAKECLMIYDKETGAITIEKLNHN 113

Query: 625 AYRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNT 765
                TR     +S +LP + +G  HN+ A G  P+ + +P +   T
Sbjct: 114 IQVKKTRNEVTNKSVQLPGQNMGQPHNQGANGAAPVAVPVPGQGSGT 160


>AY061029-1|AAL28577.1|  283|Drosophila melanogaster HL05730p
           protein.
          Length = 283

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSI 570
           GY+   + FP ++P+ PPSI
Sbjct: 61  GYYHGTLLFPREFPFKPPSI 80


>AE014297-2362|AAF55427.2|  283|Drosophila melanogaster CG5823-PA
           protein.
          Length = 283

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSI 570
           GY+   + FP ++P+ PPSI
Sbjct: 61  GYYHGTLLFPREFPFKPPSI 80


>AE013599-397|AAS64903.1|  504|Drosophila melanogaster CG11166-PG,
           isoform G protein.
          Length = 504

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 1/107 (0%)
 Frame = +1

Query: 448 RGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDY-PYSPPSIRVFN*SLGIQMYMKTEIF 624
           R  S+ VGS N  T     S      H  +  +   Y+   + +++   G     K    
Sbjct: 54  RMASVDVGSNNQVTVTVPNSESSGVPHTVYKGNQREYAKECLMIYDKETGAITIEKLNHN 113

Query: 625 AYRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNT 765
                TR     +S +LP + +G  HN+ A G  P+ + +P +   T
Sbjct: 114 IQVKKTRNEVTNKSVQLPGQNMGQPHNQGANGAAPVAVPVPGQGSGT 160


>AE013599-396|AAS64902.1|  504|Drosophila melanogaster CG11166-PF,
           isoform F protein.
          Length = 504

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 1/107 (0%)
 Frame = +1

Query: 448 RGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDY-PYSPPSIRVFN*SLGIQMYMKTEIF 624
           R  S+ VGS N  T     S      H  +  +   Y+   + +++   G     K    
Sbjct: 54  RMASVDVGSNNQVTVTVPNSESSGVPHTVYKGNQREYAKECLMIYDKETGAITIEKLNHN 113

Query: 625 AYRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNT 765
                TR     +S +LP + +G  HN+ A G  P+ + +P +   T
Sbjct: 114 IQVKKTRNEVTNKSVQLPGQNMGQPHNQGANGAAPVAVPVPGQGSGT 160


>AE013599-395|AAM68890.1|  504|Drosophila melanogaster CG11166-PE,
           isoform E protein.
          Length = 504

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 1/107 (0%)
 Frame = +1

Query: 448 RGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDY-PYSPPSIRVFN*SLGIQMYMKTEIF 624
           R  S+ VGS N  T     S      H  +  +   Y+   + +++   G     K    
Sbjct: 54  RMASVDVGSNNQVTVTVPNSESSGVPHTVYKGNQREYAKECLMIYDKETGAITIEKLNHN 113

Query: 625 AYRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNT 765
                TR     +S +LP + +G  HN+ A G  P+ + +P +   T
Sbjct: 114 IQVKKTRNEVTNKSVQLPGQNMGQPHNQGANGAAPVAVPVPGQGSGT 160


>AE013599-394|AAM68889.1|  504|Drosophila melanogaster CG11166-PD,
           isoform D protein.
          Length = 504

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 1/107 (0%)
 Frame = +1

Query: 448 RGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDY-PYSPPSIRVFN*SLGIQMYMKTEIF 624
           R  S+ VGS N  T     S      H  +  +   Y+   + +++   G     K    
Sbjct: 54  RMASVDVGSNNQVTVTVPNSESSGVPHTVYKGNQREYAKECLMIYDKETGAITIEKLNHN 113

Query: 625 AYRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNT 765
                TR     +S +LP + +G  HN+ A G  P+ + +P +   T
Sbjct: 114 IQVKKTRNEVTNKSVQLPGQNMGQPHNQGANGAAPVAVPVPGQGSGT 160


>AE013599-393|AAM68888.1|  504|Drosophila melanogaster CG11166-PC,
           isoform C protein.
          Length = 504

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 1/107 (0%)
 Frame = +1

Query: 448 RGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDY-PYSPPSIRVFN*SLGIQMYMKTEIF 624
           R  S+ VGS N  T     S      H  +  +   Y+   + +++   G     K    
Sbjct: 54  RMASVDVGSNNQVTVTVPNSESSGVPHTVYKGNQREYAKECLMIYDKETGAITIEKLNHN 113

Query: 625 AYRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNT 765
                TR     +S +LP + +G  HN+ A G  P+ + +P +   T
Sbjct: 114 IQVKKTRNEVTNKSVQLPGQNMGQPHNQGANGAAPVAVPVPGQGSGT 160


>AE013599-392|AAF59263.2|  504|Drosophila melanogaster CG11166-PA,
           isoform A protein.
          Length = 504

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 1/107 (0%)
 Frame = +1

Query: 448 RGQSI*VGSGNLRTAGYTLSSGYFKAHMKFPPDY-PYSPPSIRVFN*SLGIQMYMKTEIF 624
           R  S+ VGS N  T     S      H  +  +   Y+   + +++   G     K    
Sbjct: 54  RMASVDVGSNNQVTVTVPNSESSGVPHTVYKGNQREYAKECLMIYDKETGAITIEKLNHN 113

Query: 625 AYRFSTRPWDDPQSGELPLRTLGTLHNRFATGTPPLVISIPQRSPNT 765
                TR     +S +LP + +G  HN+ A G  P+ + +P +   T
Sbjct: 114 IQVKKTRNEVTNKSVQLPGQNMGQPHNQGANGAAPVAVPVPGQGSGT 160


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,208,998
Number of Sequences: 53049
Number of extensions: 989247
Number of successful extensions: 2793
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 2568
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2761
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3757402116
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).