SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X69045-1|CAA48790.1|  402|Drosophila melanogaster eukaryotic tra...   112   5e-25
AY121623-1|AAM51950.1|  403|Drosophila melanogaster GH17619p pro...   112   5e-25
AY069283-1|AAL39428.1|  403|Drosophila melanogaster GM14109p pro...   112   5e-25
AF145621-1|AAD38596.1|  403|Drosophila melanogaster eukaryotic i...   112   5e-25
AE014134-1011|AAN10568.1|  403|Drosophila melanogaster CG9075-PD...   112   5e-25
AE014134-1010|AAN10567.1|  403|Drosophila melanogaster CG9075-PB...   112   5e-25
AE014134-1009|AAN10566.1|  403|Drosophila melanogaster CG9075-PC...   112   5e-25
AE014134-1008|AAF52317.2|  403|Drosophila melanogaster CG9075-PA...   112   5e-25
AY089635-1|AAL90373.1|  399|Drosophila melanogaster RE50350p pro...   104   1e-22
AE014297-735|AAF54221.1|  399|Drosophila melanogaster CG7483-PA ...   104   1e-22
M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase p...    56   4e-08
AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p pro...    56   4e-08
AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB...    56   4e-08
AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA...    56   4e-08
AY071389-1|AAL49011.1|  288|Drosophila melanogaster RE44177p pro...    54   1e-07
AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box hel...    54   1e-07
AY075397-1|AAL68229.1|  827|Drosophila melanogaster LD28101p pro...    50   4e-06
AE014296-83|AAN11439.1|  827|Drosophila melanogaster CG32344-PA ...    50   4e-06
AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD0556...    48   1e-05
AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA...    48   1e-05
AY089613-1|AAL90351.1|  798|Drosophila melanogaster RE28061p pro...    46   4e-05
AE014297-778|AAF54262.1|  798|Drosophila melanogaster CG9748-PA ...    46   4e-05
AY102660-1|AAM27489.1|  818|Drosophila melanogaster GH10652p pro...    44   2e-04
AE014296-1163|AAF50635.2|  818|Drosophila melanogaster CG10077-P...    44   2e-04
AY121677-1|AAM52004.1|  507|Drosophila melanogaster RE27528p pro...    44   2e-04
AE014134-3342|AAF53963.1|  507|Drosophila melanogaster CG9253-PA...    44   2e-04
AY113641-1|AAM29646.1|  388|Drosophila melanogaster RH74035p pro...    44   3e-04
AY070624-1|AAL48095.1|  560|Drosophila melanogaster RE72861p pro...    44   3e-04
AF017777-10|AAC28406.1|  560|Drosophila melanogaster helicase pr...    44   3e-04
AE014298-3138|AAF50818.2|  560|Drosophila melanogaster CG1666-PA...    44   3e-04
U84552-1|AAC27683.1|  663|Drosophila melanogaster helicase pitch...    43   4e-04
AY119620-1|AAM50274.1|  680|Drosophila melanogaster LD46167p pro...    43   4e-04
AY071402-1|AAL49024.1|  680|Drosophila melanogaster RE48840p pro...    43   4e-04
AE014297-3091|AAN13900.2|  680|Drosophila melanogaster CG6375-PB...    43   4e-04
AE014297-3090|AAF55951.2|  680|Drosophila melanogaster CG6375-PA...    43   4e-04
AY051831-1|AAK93255.1|  703|Drosophila melanogaster LD33749p pro...    42   6e-04
AY060404-1|AAL25443.1|  945|Drosophila melanogaster LD32873p pro...    42   9e-04
AE014298-1087|AAF46295.1|  945|Drosophila melanogaster CG10777-P...    42   9e-04
X12945-1|CAA31405.1|  661|Drosophila melanogaster vasa protein.        41   0.001
BT004908-1|AAO49161.1|  782|Drosophila melanogaster LD15481p pro...    41   0.001
AF181659-1|AAD55444.1|  641|Drosophila melanogaster BcDNA.GM0530...    41   0.001
AE013599-611|AAF59119.1|  782|Drosophila melanogaster CG2173-PA ...    41   0.001
BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p pro...    41   0.002
AY051752-1|AAK93176.1|  619|Drosophila melanogaster LD28839p pro...    41   0.002
AF212866-1|AAF19985.1|  619|Drosophila melanogaster abstrakt pro...    41   0.002
AF187729-1|AAF04040.1|  614|Drosophila melanogaster DEAD-box pro...    41   0.002
AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA...    41   0.002
AE014297-15|AAF52165.1|  619|Drosophila melanogaster CG14637-PA ...    41   0.002
BT021222-1|AAX33370.1|  822|Drosophila melanogaster RH55640p pro...    40   0.003
AY060822-1|AAL28370.1|  641|Drosophila melanogaster GM01081p pro...    40   0.003
AE014134-2947|AAF53680.2|  822|Drosophila melanogaster CG10333-P...    40   0.003
M23560-1|AAA29013.1|  648|Drosophila melanogaster protein ( D.me...    40   0.003
AE014134-2564|AAF53438.1|  661|Drosophila melanogaster CG3506-PA...    40   0.003
AY061400-1|AAL28948.1|  791|Drosophila melanogaster LD32732p pro...    40   0.005
AE014296-1853|AAF50131.1|  791|Drosophila melanogaster CG6418-PB...    40   0.005
Z23266-1|CAA80804.1|  527|Drosophila melanogaster DEAD-box prote...    39   0.006
L13612-1|AAA16339.1|  527|Drosophila melanogaster DEAD-box prote...    39   0.006
AY058728-1|AAL13957.1|  521|Drosophila melanogaster LD47509p pro...    39   0.006
AE013599-778|AAF58994.1|  521|Drosophila melanogaster CG12759-PA...    39   0.006
X52846-1|CAA37037.1|  575|Drosophila melanogaster protein ( Dros...    38   0.014
BT015209-1|AAT94438.1|  575|Drosophila melanogaster RE56857p pro...    38   0.014
BT011476-1|AAR99134.1|  719|Drosophila melanogaster RE11923p pro...    38   0.014
BT001716-1|AAN71471.1|  578|Drosophila melanogaster RE68337p pro...    38   0.014
AE014297-394|AAG22212.1|  578|Drosophila melanogaster CG10279-PF...    38   0.014
AE014297-393|AAN14332.1|  578|Drosophila melanogaster CG10279-PC...    38   0.014
AE014297-392|AAF51926.2|  578|Drosophila melanogaster CG10279-PB...    38   0.014
AE014297-391|AAF51927.2|  578|Drosophila melanogaster CG10279-PE...    38   0.014
AE014297-390|AAN14331.1|  575|Drosophila melanogaster CG10279-PD...    38   0.014
AE014297-389|AAG22213.2|  719|Drosophila melanogaster CG10279-PA...    38   0.014
X79802-1|CAA56197.1|  424|Drosophila melanogaster WM6 protein.         38   0.018
L06018-1|AAB65835.1|  424|Drosophila melanogaster DECD family pu...    38   0.018
AY118921-1|AAM50781.1|  424|Drosophila melanogaster LD23644p pro...    38   0.018
AE014134-934|AAN10545.1|  424|Drosophila melanogaster CG7269-PC,...    38   0.018
AE014134-933|AAN10544.1|  424|Drosophila melanogaster CG7269-PB,...    38   0.018
AE014134-932|AAF52261.1|  424|Drosophila melanogaster CG7269-PA,...    38   0.018
AY051513-1|AAK92937.1|  613|Drosophila melanogaster GH16590p pro...    37   0.024
AE014297-721|AAF54208.1|  613|Drosophila melanogaster CG9630-PA ...    37   0.024
AY119628-1|AAM50282.1|  826|Drosophila melanogaster RE19835p pro...    37   0.032
AE014298-2591|AAF48747.2|  826|Drosophila melanogaster CG5800-PA...    37   0.032
AY058515-1|AAL13744.1|  680|Drosophila melanogaster LD21880p pro...    36   0.056
AF145609-1|AAD38584.1|  974|Drosophila melanogaster BcDNA.GH0283...    33   0.30 
AE014298-2568|AAO41693.1|  975|Drosophila melanogaster CG8611-PB...    33   0.30 
AE014298-2567|AAF48727.2|  974|Drosophila melanogaster CG8611-PA...    33   0.30 
AE014296-2963|AAF49303.1|  594|Drosophila melanogaster CG5589-PA...    33   0.52 
BT010296-1|AAQ23614.1|  813|Drosophila melanogaster LD11580p pro...    32   0.69 
AE013599-2990|AAF57487.1|  813|Drosophila melanogaster CG9143-PA...    32   0.69 
AY058512-1|AAL13741.1|  536|Drosophila melanogaster LD21669p pro...    31   1.2  
AE014134-152|AAF51458.1|  536|Drosophila melanogaster CG3561-PA ...    31   1.2  
AE014298-2574|AAO41695.1| 1740|Drosophila melanogaster CG8557-PB...    31   1.6  
AE014298-1416|AAF46559.1| 1161|Drosophila melanogaster CG15311-P...    31   1.6  
BT001389-1|AAN71144.1|  374|Drosophila melanogaster GH04919p pro...    30   2.8  
AE014297-342|AAF51960.1|  374|Drosophila melanogaster CG2091-PA ...    30   2.8  
M25292-1|AAA17840.1|  397|Drosophila melanogaster dsx protein.         30   3.7  
BT029258-1|ABK30895.1|  427|Drosophila melanogaster FI01107p pro...    30   3.7  
AY060257-1|AAL25296.1|  427|Drosophila melanogaster GH08308p pro...    30   3.7  
AE014297-676|AAF54168.2|  427|Drosophila melanogaster CG11094-PC...    30   3.7  
AE014297-675|AAN13385.1|  427|Drosophila melanogaster CG11094-PB...    30   3.7  
AE014297-674|AAF54169.1|  549|Drosophila melanogaster CG11094-PA...    30   3.7  
BT029931-1|ABM92805.1|  750|Drosophila melanogaster IP11737p pro...    29   6.4  
AY051923-1|AAK93347.1|  806|Drosophila melanogaster LD40758p pro...    29   6.4  
AE014297-3274|AAF56099.3|  806|Drosophila melanogaster CG4656-PA...    29   6.4  
AE013599-873|AAF58931.1|  466|Drosophila melanogaster CG12932-PA...    29   6.4  
DQ375985-1|ABD37876.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375981-1|ABD37872.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375980-1|ABD37871.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375979-1|ABD37870.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375974-1|ABD37865.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375973-1|ABD37864.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375971-1|ABD37862.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375970-1|ABD37861.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375969-1|ABD37860.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375967-1|ABD37858.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375964-1|ABD37855.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375961-1|ABD37852.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375960-1|ABD37851.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375959-1|ABD37850.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375958-1|ABD37849.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375951-1|ABD37842.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375945-1|ABD37836.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375944-1|ABD37835.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375943-1|ABD37834.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375942-1|ABD37833.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375941-1|ABD37832.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375939-1|ABD37830.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375938-1|ABD37829.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375936-1|ABD37827.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375934-1|ABD37825.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375931-1|ABD37822.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375930-1|ABD37821.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375929-1|ABD37820.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375927-1|ABD37818.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375926-1|ABD37817.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375924-1|ABD37815.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375920-1|ABD37811.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375919-1|ABD37810.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375914-1|ABD37805.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375910-1|ABD37801.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375909-1|ABD37800.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375903-1|ABD37794.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375902-1|ABD37793.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375901-1|ABD37792.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375899-1|ABD37790.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375898-1|ABD37789.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375896-1|ABD37787.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375893-1|ABD37784.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375891-1|ABD37782.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375890-1|ABD37781.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375889-1|ABD37780.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375887-1|ABD37778.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375884-1|ABD37775.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375882-1|ABD37773.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375880-1|ABD37771.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375879-1|ABD37770.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375875-1|ABD37766.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375873-1|ABD37764.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375871-1|ABD37762.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375870-1|ABD37761.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375868-1|ABD37759.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375867-1|ABD37758.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375860-1|ABD37751.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375859-1|ABD37750.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375854-1|ABD37745.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375849-1|ABD37740.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375848-1|ABD37739.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375845-1|ABD37736.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375844-1|ABD37735.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375843-1|ABD37734.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375841-1|ABD37732.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375836-1|ABD37727.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375835-1|ABD37726.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375833-1|ABD37724.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375829-1|ABD37720.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375827-1|ABD37718.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375824-1|ABD37715.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375822-1|ABD37713.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375820-1|ABD37711.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375819-1|ABD37710.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375818-1|ABD37709.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
DQ375815-1|ABD37706.1|  449|Drosophila melanogaster catsup prote...    29   8.5  
AY084126-1|AAL89864.1|  376|Drosophila melanogaster RE20606p pro...    29   8.5  
AY058528-1|AAL13757.1|  449|Drosophila melanogaster LD23513p pro...    29   8.5  
AF216584-1|AAF37226.1|  449|Drosophila melanogaster seven transm...    29   8.5  
AE014134-3021|AAF53744.1|  449|Drosophila melanogaster CG10449-P...    29   8.5  

>X69045-1|CAA48790.1|  402|Drosophila melanogaster eukaryotic
           translation initiationfactor 4A (eIF-4A) protein.
          Length = 402

 Score =  112 bits (269), Expect = 5e-25
 Identities = 54/67 (80%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNVR
Sbjct: 80  KTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVR 139

Query: 434 EDIRQLE 454
           ED R LE
Sbjct: 140 EDARILE 146



 Score =  107 bits (258), Expect = 1e-23
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + + W +V + FDDMNL+EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGT
Sbjct: 19  GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 25/47 (53%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADENVVPEVFKGPDPLM-VFKMV 624
           GRVYDMI   +     IKLFVLDEADE ++   FK  D +  VFKM+
Sbjct: 157 GRVYDMINR-KLRTQYIKLFVLDEADE-MLSRGFK--DQIQDVFKML 199


>AY121623-1|AAM51950.1|  403|Drosophila melanogaster GH17619p
           protein.
          Length = 403

 Score =  112 bits (269), Expect = 5e-25
 Identities = 54/67 (80%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNVR
Sbjct: 80  KTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVR 139

Query: 434 EDIRQLE 454
           ED R LE
Sbjct: 140 EDARILE 146



 Score =  107 bits (258), Expect = 1e-23
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + + W +V + FDDMNL+EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGT
Sbjct: 19  GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score = 35.9 bits (79), Expect = 0.056
 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADENVVPEVFKGPDPLM-VFKMV 624
           GRVYDMI         IKLFVLDEADE ++   FK  D +  VFKM+
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADE-MLSRGFK--DQIQDVFKML 200


>AY069283-1|AAL39428.1|  403|Drosophila melanogaster GM14109p
           protein.
          Length = 403

 Score =  112 bits (269), Expect = 5e-25
 Identities = 54/67 (80%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNVR
Sbjct: 80  KTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVR 139

Query: 434 EDIRQLE 454
           ED R LE
Sbjct: 140 EDARILE 146



 Score =  107 bits (258), Expect = 1e-23
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + + W +V + FDDMNL+EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGT
Sbjct: 19  GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score = 35.9 bits (79), Expect = 0.056
 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADENVVPEVFKGPDPLM-VFKMV 624
           GRVYDMI         IKLFVLDEADE ++   FK  D +  VFKM+
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADE-MLSRGFK--DQIQDVFKML 200


>AF145621-1|AAD38596.1|  403|Drosophila melanogaster eukaryotic
           initiation factor-4a protein.
          Length = 403

 Score =  112 bits (269), Expect = 5e-25
 Identities = 54/67 (80%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNVR
Sbjct: 80  KTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVR 139

Query: 434 EDIRQLE 454
           ED R LE
Sbjct: 140 EDARILE 146



 Score =  107 bits (258), Expect = 1e-23
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + + W +V + FDDMNL+EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGT
Sbjct: 19  GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score = 35.9 bits (79), Expect = 0.056
 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADENVVPEVFKGPDPLM-VFKMV 624
           GRVYDMI         IKLFVLDEADE ++   FK  D +  VFKM+
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADE-MLSRGFK--DQIQDVFKML 200


>AE014134-1011|AAN10568.1|  403|Drosophila melanogaster CG9075-PD,
           isoform D protein.
          Length = 403

 Score =  112 bits (269), Expect = 5e-25
 Identities = 54/67 (80%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNVR
Sbjct: 80  KTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVR 139

Query: 434 EDIRQLE 454
           ED R LE
Sbjct: 140 EDARILE 146



 Score =  107 bits (258), Expect = 1e-23
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + + W +V + FDDMNL+EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGT
Sbjct: 19  GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score = 35.9 bits (79), Expect = 0.056
 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADENVVPEVFKGPDPLM-VFKMV 624
           GRVYDMI         IKLFVLDEADE ++   FK  D +  VFKM+
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADE-MLSRGFK--DQIQDVFKML 200


>AE014134-1010|AAN10567.1|  403|Drosophila melanogaster CG9075-PB,
           isoform B protein.
          Length = 403

 Score =  112 bits (269), Expect = 5e-25
 Identities = 54/67 (80%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNVR
Sbjct: 80  KTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVR 139

Query: 434 EDIRQLE 454
           ED R LE
Sbjct: 140 EDARILE 146



 Score =  107 bits (258), Expect = 1e-23
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + + W +V + FDDMNL+EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGT
Sbjct: 19  GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score = 35.9 bits (79), Expect = 0.056
 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADENVVPEVFKGPDPLM-VFKMV 624
           GRVYDMI         IKLFVLDEADE ++   FK  D +  VFKM+
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADE-MLSRGFK--DQIQDVFKML 200


>AE014134-1009|AAN10566.1|  403|Drosophila melanogaster CG9075-PC,
           isoform C protein.
          Length = 403

 Score =  112 bits (269), Expect = 5e-25
 Identities = 54/67 (80%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNVR
Sbjct: 80  KTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVR 139

Query: 434 EDIRQLE 454
           ED R LE
Sbjct: 140 EDARILE 146



 Score =  107 bits (258), Expect = 1e-23
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + + W +V + FDDMNL+EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGT
Sbjct: 19  GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score = 35.9 bits (79), Expect = 0.056
 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADENVVPEVFKGPDPLM-VFKMV 624
           GRVYDMI         IKLFVLDEADE ++   FK  D +  VFKM+
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADE-MLSRGFK--DQIQDVFKML 200


>AE014134-1008|AAF52317.2|  403|Drosophila melanogaster CG9075-PA,
           isoform A protein.
          Length = 403

 Score =  112 bits (269), Expect = 5e-25
 Identities = 54/67 (80%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNVR
Sbjct: 80  KTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVR 139

Query: 434 EDIRQLE 454
           ED R LE
Sbjct: 140 EDARILE 146



 Score =  107 bits (258), Expect = 1e-23
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + + W +V + FDDMNL+EELLRGIY YGFEKPSAIQQRAI+PC++GRDVIAQAQSGT
Sbjct: 19  GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score = 35.9 bits (79), Expect = 0.056
 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADENVVPEVFKGPDPLM-VFKMV 624
           GRVYDMI         IKLFVLDEADE ++   FK  D +  VFKM+
Sbjct: 157 GRVYDMINRKVLRTQYIKLFVLDEADE-MLSRGFK--DQIQDVFKML 200


>AY089635-1|AAL90373.1|  399|Drosophila melanogaster RE50350p
           protein.
          Length = 399

 Score =  104 bits (250), Expect = 1e-22
 Identities = 47/67 (70%), Positives = 58/67 (86%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSISILQ +DT++RE Q L L+PTRELA QIQKV++ALGD +N +CH CIGGTN+ 
Sbjct: 76  KTATFSISILQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLG 135

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 136 EDIRKLD 142



 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 44/54 (81%), Positives = 50/54 (92%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +V+ TF+ MNLKEELLRGIYAYGFEKPSAIQQR+I P ++GRDVIAQAQSGTGK
Sbjct: 23  EVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGK 76



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IK+ VLDEADE
Sbjct: 153 GRVFDMIKRRVLRTRAIKMLVLDEADE 179


>AE014297-735|AAF54221.1|  399|Drosophila melanogaster CG7483-PA
           protein.
          Length = 399

 Score =  104 bits (250), Expect = 1e-22
 Identities = 47/67 (70%), Positives = 58/67 (86%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSISILQ +DT++RE Q L L+PTRELA QIQKV++ALGD +N +CH CIGGTN+ 
Sbjct: 76  KTATFSISILQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLG 135

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 136 EDIRKLD 142



 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 44/54 (81%), Positives = 50/54 (92%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +V+ TF+ MNLKEELLRGIYAYGFEKPSAIQQR+I P ++GRDVIAQAQSGTGK
Sbjct: 23  EVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGK 76



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IK+ VLDEADE
Sbjct: 153 GRVFDMIKRRVLRTRAIKMLVLDEADE 179


>M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase
           protein.
          Length = 459

 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 25/49 (51%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F++  LK ELL GI+  G+E+PS IQ+ AI   + G+DV+A+A++GTGK
Sbjct: 60  FEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGK 108



 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 26/66 (39%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  + I +L+QID +    QAL++ PTRELA Q  ++ I L  HL+ +     GGT ++
Sbjct: 108 KTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILK 167

Query: 434 EDIRQL 451
           +DI ++
Sbjct: 168 DDILRI 173


>AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p
           protein.
          Length = 459

 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 25/49 (51%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F++  LK ELL GI+  G+E+PS IQ+ AI   + G+DV+A+A++GTGK
Sbjct: 60  FEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGK 108



 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 26/66 (39%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  + I +L+QID +    QAL++ PTRELA Q  ++ I L  HL+ +     GGT ++
Sbjct: 108 KTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILK 167

Query: 434 EDIRQL 451
           +DI ++
Sbjct: 168 DDILRI 173


>AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB,
           isoform B protein.
          Length = 428

 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 25/49 (51%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F++  LK ELL GI+  G+E+PS IQ+ AI   + G+DV+A+A++GTGK
Sbjct: 29  FEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGK 77



 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 26/66 (39%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  + I +L+QID +    QAL++ PTRELA Q  ++ I L  HL+ +     GGT ++
Sbjct: 77  KTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILK 136

Query: 434 EDIRQL 451
           +DI ++
Sbjct: 137 DDILRI 142


>AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA,
           isoform A protein.
          Length = 459

 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 25/49 (51%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F++  LK ELL GI+  G+E+PS IQ+ AI   + G+DV+A+A++GTGK
Sbjct: 60  FEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGK 108



 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 26/66 (39%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  + I +L+QID +    QAL++ PTRELA Q  ++ I L  HL+ +     GGT ++
Sbjct: 108 KTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILK 167

Query: 434 EDIRQL 451
           +DI ++
Sbjct: 168 DDILRI 173


>AY071389-1|AAL49011.1|  288|Drosophila melanogaster RE44177p
           protein.
          Length = 288

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           V+TF+ ++LK  LL+GIYA GF  PS IQ+ A+   +    +++IAQ+QSGTGK
Sbjct: 72  VKTFEALHLKASLLKGIYAMGFNTPSKIQETALPTLLADPPQNMIAQSQSGTGK 125



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L +++  +   Q L L+PT ELA Q  +V   +G
Sbjct: 125 KTAAFVLAMLSRVNVCLNHPQVLCLSPTYELAIQTGEVAARMG 167


>AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box
           helicase protein.
          Length = 460

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           V+TF+ ++LK  LL+GIYA GF  PS IQ+ A+   +    +++IAQ+QSGTGK
Sbjct: 72  VKTFEALHLKASLLKGIYAMGFNTPSKIQETALPTLLADPPQNMIAQSQSGTGK 125



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L +++  +   Q L L+PT ELA Q  +V   +G
Sbjct: 125 KTAAFVLAMLSRVNVCLNHPQVLCLSPTYELAIQTGEVAARMG 167


>AY075397-1|AAL68229.1|  827|Drosophila melanogaster LD28101p
           protein.
          Length = 827

 Score = 49.6 bits (113), Expect = 4e-06
 Identities = 23/60 (38%), Positives = 37/60 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F  M L  EL++GI   G++ P+ IQ++ I   ++GRDV+A A++G+GK    L   + K
Sbjct: 41  FQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEK 100



 Score = 38.3 bits (85), Expect = 0.011
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 2/61 (3%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS--IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I + +++      +  +ALIL+PTRELA Q  K +  LG  +  K    +GG +
Sbjct: 89  KTACFLIPLFEKLQRREPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDS 148

Query: 428 V 430
           +
Sbjct: 149 M 149


>AE014296-83|AAN11439.1|  827|Drosophila melanogaster CG32344-PA
           protein.
          Length = 827

 Score = 49.6 bits (113), Expect = 4e-06
 Identities = 23/60 (38%), Positives = 37/60 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F  M L  EL++GI   G++ P+ IQ++ I   ++GRDV+A A++G+GK    L   + K
Sbjct: 41  FQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEK 100



 Score = 38.3 bits (85), Expect = 0.011
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 2/61 (3%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS--IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I + +++      +  +ALIL+PTRELA Q  K +  LG  +  K    +GG +
Sbjct: 89  KTACFLIPLFEKLQRREPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDS 148

Query: 428 V 430
           +
Sbjct: 149 M 149


>AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD05563
           protein.
          Length = 1028

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL-GDHLNAKCHACIGGTNV 430
           KT  + I+++Q  + +I +  A+I+ PTRELA Q+Q     L     + KC A IGGT+V
Sbjct: 75  KTLIYVIAVVQSFNPNINQPHAMIVVPTRELAIQVQDTFFHLCKSFRDFKCSAFIGGTDV 134

Query: 431 REDIRQL 451
            +D +++
Sbjct: 135 AKDRKRM 141


>AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA
           protein.
          Length = 1028

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL-GDHLNAKCHACIGGTNV 430
           KT  + I+++Q  + +I +  A+I+ PTRELA Q+Q     L     + KC A IGGT+V
Sbjct: 75  KTLIYVIAVVQSFNPNINQPHAMIVVPTRELAIQVQDTFFHLCKSFRDFKCSAFIGGTDV 134

Query: 431 REDIRQL 451
            +D +++
Sbjct: 135 AKDRKRM 141


>AY089613-1|AAL90351.1|  798|Drosophila melanogaster RE28061p
           protein.
          Length = 798

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRF 281
           + +FDD+ L E +   +    ++KP+ +Q+ AI   I GRD++A AQ+G+GK    L   
Sbjct: 294 ITSFDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPI 353

Query: 282 YNK 290
            N+
Sbjct: 354 LNQ 356



 Score = 32.3 bits (70), Expect = 0.69
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELA QI +           +     GG N  E +R+L+
Sbjct: 382 LVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELD 426


>AE014297-778|AAF54262.1|  798|Drosophila melanogaster CG9748-PA
           protein.
          Length = 798

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRF 281
           + +FDD+ L E +   +    ++KP+ +Q+ AI   I GRD++A AQ+G+GK    L   
Sbjct: 294 ITSFDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPI 353

Query: 282 YNK 290
            N+
Sbjct: 354 LNQ 356



 Score = 32.3 bits (70), Expect = 0.69
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELA QI +           +     GG N  E +R+L+
Sbjct: 382 LVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELD 426


>AY102660-1|AAM27489.1|  818|Drosophila melanogaster GH10652p
           protein.
          Length = 818

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 22/46 (47%), Positives = 28/46 (60%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V I  G + + +     GG    +  R LE
Sbjct: 233 ALVLAPTRELAQQIQQVAIEFGSNTHVRNTCIFGGAPKGQQARDLE 278



 Score = 39.1 bits (87), Expect = 0.006
 Identities = 18/51 (35%), Positives = 30/51 (58%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           F++    + ++  I   GF KP+AIQ +     + GRD++  AQ+G+GK L
Sbjct: 159 FEEGGFPDYVMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTL 209


>AE014296-1163|AAF50635.2|  818|Drosophila melanogaster CG10077-PA,
           isoform A protein.
          Length = 818

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 22/46 (47%), Positives = 28/46 (60%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V I  G + + +     GG    +  R LE
Sbjct: 233 ALVLAPTRELAQQIQQVAIEFGSNTHVRNTCIFGGAPKGQQARDLE 278



 Score = 39.1 bits (87), Expect = 0.006
 Identities = 18/51 (35%), Positives = 30/51 (58%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           F++    + ++  I   GF KP+AIQ +     + GRD++  AQ+G+GK L
Sbjct: 159 FEEGGFPDYVMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTL 209


>AY121677-1|AAM52004.1|  507|Drosophila melanogaster RE27528p
           protein.
          Length = 507

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/59 (38%), Positives = 34/59 (57%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  KC   +GG ++
Sbjct: 111 KTGAFALPILHALLENPQRYFALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDM 169



 Score = 41.9 bits (94), Expect = 9e-04
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           T+ D+ L E L +      ++ PS IQ+ AI   +QG+DVI  A++G+GK
Sbjct: 62  TWKDLGLNEALCQACDELKWKAPSKIQREAIPVALQGKDVIGLAETGSGK 111


>AE014134-3342|AAF53963.1|  507|Drosophila melanogaster CG9253-PA
           protein.
          Length = 507

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/59 (38%), Positives = 34/59 (57%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  KC   +GG ++
Sbjct: 111 KTGAFALPILHALLENPQRYFALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDM 169



 Score = 41.9 bits (94), Expect = 9e-04
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           T+ D+ L E L +      ++ PS IQ+ AI   +QG+DVI  A++G+GK
Sbjct: 62  TWKDLGLNEALCQACDELKWKAPSKIQREAIPVALQGKDVIGLAETGSGK 111


>AY113641-1|AAM29646.1|  388|Drosophila melanogaster RH74035p
           protein.
          Length = 388

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 16/49 (32%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++ L + +L+ +   G+++P+ IQ  AI   ++G+DV+ +A++G+GK
Sbjct: 11  FHELELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGK 59



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 17/44 (38%), Positives = 31/44 (70%), Gaps = 5/44 (11%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVV 370
           KTAT+++ ++Q+I     + S +   A++LAPT+EL +Q +KV+
Sbjct: 59  KTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVI 102


>AY070624-1|AAL48095.1|  560|Drosophila melanogaster RE72861p
           protein.
          Length = 560

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 16/49 (32%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++ L + +L+ +   G+++P+ IQ  AI   ++G+DV+ +A++G+GK
Sbjct: 11  FHELELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGK 59



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 17/44 (38%), Positives = 31/44 (70%), Gaps = 5/44 (11%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVV 370
           KTAT+++ ++Q+I     + S +   A++LAPT+EL +Q +KV+
Sbjct: 59  KTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVI 102


>AF017777-10|AAC28406.1|  560|Drosophila melanogaster helicase
           protein.
          Length = 560

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 16/49 (32%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++ L + +L+ +   G+++P+ IQ  AI   ++G+DV+ +A++G+GK
Sbjct: 11  FHELELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGK 59



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 17/44 (38%), Positives = 31/44 (70%), Gaps = 5/44 (11%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVV 370
           KTAT+++ ++Q+I     + S +   A++LAPT+EL +Q +KV+
Sbjct: 59  KTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVI 102


>AE014298-3138|AAF50818.2|  560|Drosophila melanogaster CG1666-PA
           protein.
          Length = 560

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 16/49 (32%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++ L + +L+ +   G+++P+ IQ  AI   ++G+DV+ +A++G+GK
Sbjct: 11  FHELELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGK 59



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 17/44 (38%), Positives = 31/44 (70%), Gaps = 5/44 (11%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVV 370
           KTAT+++ ++Q+I     + S +   A++LAPT+EL +Q +KV+
Sbjct: 59  KTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVI 102


>U84552-1|AAC27683.1|  663|Drosophila melanogaster helicase
           pitchoune protein.
          Length = 663

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  LR I   GF + + IQ +++ P ++GRD++  AQ+G+GK L  L
Sbjct: 177 VSEATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFL 225


>AY119620-1|AAM50274.1|  680|Drosophila melanogaster LD46167p
           protein.
          Length = 680

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  LR I   GF + + IQ +++ P ++GRD++  AQ+G+GK L  L
Sbjct: 194 VSEATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFL 242


>AY071402-1|AAL49024.1|  680|Drosophila melanogaster RE48840p
           protein.
          Length = 680

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  LR I   GF + + IQ +++ P ++GRD++  AQ+G+GK L  L
Sbjct: 194 VSEATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFL 242


>AE014297-3091|AAN13900.2|  680|Drosophila melanogaster CG6375-PB,
           isoform B protein.
          Length = 680

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  LR I   GF + + IQ +++ P ++GRD++  AQ+G+GK L  L
Sbjct: 194 VSEATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFL 242


>AE014297-3090|AAF55951.2|  680|Drosophila melanogaster CG6375-PA,
           isoform A protein.
          Length = 680

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  LR I   GF + + IQ +++ P ++GRD++  AQ+G+GK L  L
Sbjct: 194 VSEATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFL 242


>AY051831-1|AAK93255.1|  703|Drosophila melanogaster LD33749p
           protein.
          Length = 703

 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 22/46 (47%), Positives = 28/46 (60%)
 Frame = +3

Query: 135 ELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++L  I   GF KPS IQ +A    +QG D+I  AQ+GTGK L  L
Sbjct: 293 DMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFL 338


>AY060404-1|AAL25443.1|  945|Drosophila melanogaster LD32873p
           protein.
          Length = 945

 Score = 41.9 bits (94), Expect = 9e-04
 Identities = 19/54 (35%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V +F++ +L   ++  +   GF KP+AIQ +     + GRD++  AQ+G+GK L
Sbjct: 236 VVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTL 289



 Score = 39.1 bits (87), Expect = 0.006
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKC-HACI-GGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ VV   G     +  H CI GG++     R L+
Sbjct: 313 ALVLAPTRELAQQIQSVVRDYGHLCKPEIRHTCIFGGSSKVPQARDLD 360


>AE014298-1087|AAF46295.1|  945|Drosophila melanogaster CG10777-PB
           protein.
          Length = 945

 Score = 41.9 bits (94), Expect = 9e-04
 Identities = 19/54 (35%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V +F++ +L   ++  +   GF KP+AIQ +     + GRD++  AQ+G+GK L
Sbjct: 236 VVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTL 289



 Score = 39.1 bits (87), Expect = 0.006
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKC-HACI-GGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ VV   G     +  H CI GG++     R L+
Sbjct: 313 ALVLAPTRELAQQIQSVVRDYGHLCKPEIRHTCIFGGSSKVPQARDLD 360


>X12945-1|CAA31405.1|  661|Drosophila melanogaster vasa protein.
          Length = 661

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 21/72 (29%), Positives = 41/72 (56%)
 Frame = +3

Query: 84  TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +D  Q ++ F   +L++ ++  +   GF+ P+ IQ+ +I     GRD++A AQ+G+GK  
Sbjct: 238 SDVPQPIQHFTSADLRDIIIDNVNKSGFKIPTPIQKCSIPVISSGRDLMACAQTGSGKTA 297

Query: 264 LSLYRFYNKSIQ 299
             L    +K ++
Sbjct: 298 AFLLPILSKLLE 309



 Score = 28.7 bits (61), Expect = 8.5
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 5/65 (7%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA F + IL ++     +  +   Q +I++PTRELA QI             K     G
Sbjct: 295 KTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYG 354

Query: 419 GTNVR 433
           GT+ R
Sbjct: 355 GTSFR 359


>BT004908-1|AAO49161.1|  782|Drosophila melanogaster LD15481p
           protein.
          Length = 782

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++ + +F  MNL   L+R I   G+  P+ IQ   I   + GRD+   A +GTGK
Sbjct: 153 NEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGK 207


>AF181659-1|AAD55444.1|  641|Drosophila melanogaster BcDNA.GM05306
           protein.
          Length = 641

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++ + +F  MNL   L+R I   G+  P+ IQ   I   + GRD+   A +GTGK
Sbjct: 153 NEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGK 207


>AE013599-611|AAF59119.1|  782|Drosophila melanogaster CG2173-PA
           protein.
          Length = 782

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++ + +F  MNL   L+R I   G+  P+ IQ   I   + GRD+   A +GTGK
Sbjct: 153 NEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGK 207


>BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p
           protein.
          Length = 1224

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 19/54 (35%), Positives = 34/54 (62%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++T+    + ++ +  +   GFEKP+ IQ +AI   + GRD+I  A++G+GK L
Sbjct: 509 IKTWAQCGVSKKEMEVLRRLGFEKPTPIQCQAIPAIMSGRDLIGIAKTGSGKTL 562



 Score = 35.9 bits (79), Expect = 0.056
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+I+APTREL  QI K +      L  +     GGT + E I +L+
Sbjct: 586 AIIMAPTRELCMQIGKDIRKFSKSLGLRPVCVYGGTGISEQIAELK 631


>AY051752-1|AAK93176.1|  619|Drosophila melanogaster LD28839p
           protein.
          Length = 619

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/55 (32%), Positives = 33/55 (60%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           + +F +M   + +L G+ A G + P+ IQ + +   + GRD+I  A +G+GK L+
Sbjct: 176 IRSFREMKFPKGILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLV 230


>AF212866-1|AAF19985.1|  619|Drosophila melanogaster abstrakt
           protein protein.
          Length = 619

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/55 (32%), Positives = 33/55 (60%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           + +F +M   + +L G+ A G + P+ IQ + +   + GRD+I  A +G+GK L+
Sbjct: 176 IRSFREMKFPKGILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLV 230


>AF187729-1|AAF04040.1|  614|Drosophila melanogaster DEAD-box
           protein abstrakt protein.
          Length = 614

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/55 (32%), Positives = 33/55 (60%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           + +F +M   + +L G+ A G + P+ IQ + +   + GRD+I  A +G+GK L+
Sbjct: 171 IRSFREMKFPKGILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLV 225


>AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA
           protein.
          Length = 1224

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 19/54 (35%), Positives = 34/54 (62%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++T+    + ++ +  +   GFEKP+ IQ +AI   + GRD+I  A++G+GK L
Sbjct: 509 IKTWAQCGVSKKEMEVLRRLGFEKPTPIQCQAIPAIMSGRDLIGIAKTGSGKTL 562



 Score = 35.9 bits (79), Expect = 0.056
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+I+APTREL  QI K +      L  +     GGT + E I +L+
Sbjct: 586 AIIMAPTRELCMQIGKDIRKFSKSLGLRPVCVYGGTGISEQIAELK 631


>AE014297-15|AAF52165.1|  619|Drosophila melanogaster CG14637-PA
           protein.
          Length = 619

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/55 (32%), Positives = 33/55 (60%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           + +F +M   + +L G+ A G + P+ IQ + +   + GRD+I  A +G+GK L+
Sbjct: 176 IRSFREMKFPKGILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLV 230


>BT021222-1|AAX33370.1|  822|Drosophila melanogaster RH55640p
           protein.
          Length = 822

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 18/57 (31%), Positives = 37/57 (64%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + ++++    +E++  I   G+++P+ IQ++AI   +Q RD+I  A++G+GK L  L
Sbjct: 393 IRSWNESGFPKEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFL 449



 Score = 38.7 bits (86), Expect = 0.008
 Identities = 22/66 (33%), Positives = 34/66 (51%)
 Frame = +2

Query: 239 PVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           P+ +W  +   I  L+ +D       A+I+APTRELAQQI++     G  L  +    +G
Sbjct: 451 PLLSWIQSLPKIERLEDVDQGP---YAIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVG 507

Query: 419 GTNVRE 436
           G +  E
Sbjct: 508 GLSREE 513


>AY060822-1|AAL28370.1|  641|Drosophila melanogaster GM01081p
           protein.
          Length = 641

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 18/57 (31%), Positives = 37/57 (64%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + ++++    +E++  I   G+++P+ IQ++AI   +Q RD+I  A++G+GK L  L
Sbjct: 212 IRSWNESGFPKEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFL 268



 Score = 38.7 bits (86), Expect = 0.008
 Identities = 22/66 (33%), Positives = 34/66 (51%)
 Frame = +2

Query: 239 PVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           P+ +W  +   I  L+ +D       A+I+APTRELAQQI++     G  L  +    +G
Sbjct: 270 PLLSWIQSLPKIERLEDVDQGP---YAIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVG 326

Query: 419 GTNVRE 436
           G +  E
Sbjct: 327 GLSREE 332


>AE014134-2947|AAF53680.2|  822|Drosophila melanogaster CG10333-PA
           protein.
          Length = 822

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 18/57 (31%), Positives = 37/57 (64%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + ++++    +E++  I   G+++P+ IQ++AI   +Q RD+I  A++G+GK L  L
Sbjct: 393 IRSWNESGFPKEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFL 449



 Score = 38.7 bits (86), Expect = 0.008
 Identities = 22/66 (33%), Positives = 34/66 (51%)
 Frame = +2

Query: 239 PVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           P+ +W  +   I  L+ +D       A+I+APTRELAQQI++     G  L  +    +G
Sbjct: 451 PLLSWIQSLPKIERLEDVDQGP---YAIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVG 507

Query: 419 GTNVRE 436
           G +  E
Sbjct: 508 GLSREE 513


>M23560-1|AAA29013.1|  648|Drosophila melanogaster protein (
           D.melanogaster antigenMab46F11 (vasa) mRNA, complete
           cds. ).
          Length = 648

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 20/72 (27%), Positives = 41/72 (56%)
 Frame = +3

Query: 84  TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +D  Q ++ F   +L++ ++  +   G++ P+ IQ+ +I     GRD++A AQ+G+GK  
Sbjct: 225 SDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTA 284

Query: 264 LSLYRFYNKSIQ 299
             L    +K ++
Sbjct: 285 AFLLPILSKLLE 296


>AE014134-2564|AAF53438.1|  661|Drosophila melanogaster CG3506-PA
           protein.
          Length = 661

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 20/72 (27%), Positives = 41/72 (56%)
 Frame = +3

Query: 84  TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +D  Q ++ F   +L++ ++  +   G++ P+ IQ+ +I     GRD++A AQ+G+GK  
Sbjct: 238 SDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTA 297

Query: 264 LSLYRFYNKSIQ 299
             L    +K ++
Sbjct: 298 AFLLPILSKLLE 309



 Score = 28.7 bits (61), Expect = 8.5
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 5/65 (7%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA F + IL ++     +  +   Q +I++PTRELA QI             K     G
Sbjct: 295 KTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYG 354

Query: 419 GTNVR 433
           GT+ R
Sbjct: 355 GTSFR 359


>AY061400-1|AAL28948.1|  791|Drosophila melanogaster LD32732p
           protein.
          Length = 791

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 16/52 (30%), Positives = 31/52 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V +F      E+L++ +    + +P+ IQ +A+   + GRD+I  A++G+GK
Sbjct: 268 VTSFGHFGFDEQLIKAVRKAEYTQPTPIQAQAVPTALSGRDIIGIAKTGSGK 319



 Score = 33.1 bits (72), Expect = 0.40
 Identities = 19/45 (42%), Positives = 22/45 (48%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           LILAPTREL+ QI       G   N     C GG +  E  + LE
Sbjct: 346 LILAPTRELSLQIYNEAKKFGKVYNLNVVCCYGGGSKWEQSKALE 390


>AE014296-1853|AAF50131.1|  791|Drosophila melanogaster CG6418-PB
           protein.
          Length = 791

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 16/52 (30%), Positives = 31/52 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V +F      E+L++ +    + +P+ IQ +A+   + GRD+I  A++G+GK
Sbjct: 268 VTSFGHFGFDEQLIKAVRKAEYTQPTPIQAQAVPTALSGRDIIGIAKTGSGK 319



 Score = 33.1 bits (72), Expect = 0.40
 Identities = 19/45 (42%), Positives = 22/45 (48%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           LILAPTREL+ QI       G   N     C GG +  E  + LE
Sbjct: 346 LILAPTRELSLQIYNEAKKFGKVYNLNVVCCYGGGSKWEQSKALE 390


>Z23266-1|CAA80804.1|  527|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 527

 Score = 39.1 bits (87), Expect = 0.006
 Identities = 21/76 (27%), Positives = 38/76 (50%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C  ++   + KT  F++ IL+++        AL+L PT ELA QI +  +  G  +  + 
Sbjct: 47  CIGAAKTGSGKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRV 106

Query: 404 HACIGGTNVREDIRQL 451
               GGT+   + ++L
Sbjct: 107 CVVSGGTDQMVESQKL 122



 Score = 32.3 bits (70), Expect = 0.69
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L+  L++ +   G +  + IQQ+ I   + G+D I  A++G+GK
Sbjct: 9   FQILGLRPWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGK 57


>L13612-1|AAA16339.1|  527|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 527

 Score = 39.1 bits (87), Expect = 0.006
 Identities = 21/76 (27%), Positives = 38/76 (50%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C  ++   + KT  F++ IL+++        AL+L PT ELA QI +  +  G  +  + 
Sbjct: 47  CIGAAKTGSGKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRV 106

Query: 404 HACIGGTNVREDIRQL 451
               GGT+   + ++L
Sbjct: 107 CVVSGGTDQMVESQKL 122



 Score = 32.3 bits (70), Expect = 0.69
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L+  L++ +   G +  + IQQ+ I   + G+D I  A++G+GK
Sbjct: 9   FQILGLRPWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGK 57


>AY058728-1|AAL13957.1|  521|Drosophila melanogaster LD47509p
           protein.
          Length = 521

 Score = 39.1 bits (87), Expect = 0.006
 Identities = 21/76 (27%), Positives = 38/76 (50%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C  ++   + KT  F++ IL+++        AL+L PT ELA QI +  +  G  +  + 
Sbjct: 47  CIGAAKTGSGKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRV 106

Query: 404 HACIGGTNVREDIRQL 451
               GGT+   + ++L
Sbjct: 107 CVVSGGTDQMVESQKL 122



 Score = 32.3 bits (70), Expect = 0.69
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L+  L++ +   G +  + IQQ+ I   + G+D I  A++G+GK
Sbjct: 9   FQILGLRPWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGK 57


>AE013599-778|AAF58994.1|  521|Drosophila melanogaster CG12759-PA
           protein.
          Length = 521

 Score = 39.1 bits (87), Expect = 0.006
 Identities = 21/76 (27%), Positives = 38/76 (50%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C  ++   + KT  F++ IL+++        AL+L PT ELA QI +  +  G  +  + 
Sbjct: 47  CIGAAKTGSGKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRV 106

Query: 404 HACIGGTNVREDIRQL 451
               GGT+   + ++L
Sbjct: 107 CVVSGGTDQMVESQKL 122



 Score = 32.3 bits (70), Expect = 0.69
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L+  L++ +   G +  + IQQ+ I   + G+D I  A++G+GK
Sbjct: 9   FQILGLRPWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGK 57


>X52846-1|CAA37037.1|  575|Drosophila melanogaster protein (
           Drosophila melanogasterRM62 mRNA for novel RNA helicase.
           ).
          Length = 575

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 213 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 258



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 136 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 189


>BT015209-1|AAT94438.1|  575|Drosophila melanogaster RE56857p
           protein.
          Length = 575

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 213 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 258



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 136 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 189


>BT011476-1|AAR99134.1|  719|Drosophila melanogaster RE11923p
           protein.
          Length = 719

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 357 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 402



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 280 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 333


>BT001716-1|AAN71471.1|  578|Drosophila melanogaster RE68337p
           protein.
          Length = 578

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 261



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 139 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 192


>AE014297-394|AAG22212.1|  578|Drosophila melanogaster CG10279-PF,
           isoform F protein.
          Length = 578

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 261



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 139 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 192


>AE014297-393|AAN14332.1|  578|Drosophila melanogaster CG10279-PC,
           isoform C protein.
          Length = 578

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 261



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 139 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 192


>AE014297-392|AAF51926.2|  578|Drosophila melanogaster CG10279-PB,
           isoform B protein.
          Length = 578

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 261



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 139 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 192


>AE014297-391|AAF51927.2|  578|Drosophila melanogaster CG10279-PE,
           isoform E protein.
          Length = 578

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 261



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 139 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 192


>AE014297-390|AAN14331.1|  575|Drosophila melanogaster CG10279-PD,
           isoform D protein.
          Length = 575

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 213 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 258



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 136 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 189


>AE014297-389|AAG22213.2|  719|Drosophila melanogaster CG10279-PA,
           isoform A protein.
          Length = 719

 Score = 37.9 bits (84), Expect = 0.014
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+
Sbjct: 357 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQ 402



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 14/54 (25%), Positives = 33/54 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F +++L + +++ I   G++ P+AIQ +     + G + +  A++G+GK L
Sbjct: 280 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTL 333


>X79802-1|CAA56197.1|  424|Drosophila melanogaster WM6 protein.
          Length = 424

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 427
           KTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG  
Sbjct: 91  KTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMA 150

Query: 428 VREDIRQLE 454
           +++D   L+
Sbjct: 151 IQKDEETLK 159


>L06018-1|AAB65835.1|  424|Drosophila melanogaster DECD family
           putative RNA helicase protein.
          Length = 424

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 427
           KTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG  
Sbjct: 91  KTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMA 150

Query: 428 VREDIRQLE 454
           +++D   L+
Sbjct: 151 IQKDEETLK 159


>AY118921-1|AAM50781.1|  424|Drosophila melanogaster LD23644p
           protein.
          Length = 424

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 427
           KTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG  
Sbjct: 91  KTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMA 150

Query: 428 VREDIRQLE 454
           +++D   L+
Sbjct: 151 IQKDEETLK 159


>AE014134-934|AAN10545.1|  424|Drosophila melanogaster CG7269-PC,
           isoform C protein.
          Length = 424

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 427
           KTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG  
Sbjct: 91  KTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMA 150

Query: 428 VREDIRQLE 454
           +++D   L+
Sbjct: 151 IQKDEETLK 159


>AE014134-933|AAN10544.1|  424|Drosophila melanogaster CG7269-PB,
           isoform B protein.
          Length = 424

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 427
           KTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG  
Sbjct: 91  KTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMA 150

Query: 428 VREDIRQLE 454
           +++D   L+
Sbjct: 151 IQKDEETLK 159


>AE014134-932|AAF52261.1|  424|Drosophila melanogaster CG7269-PA,
           isoform A protein.
          Length = 424

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 427
           KTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG  
Sbjct: 91  KTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMA 150

Query: 428 VREDIRQLE 454
           +++D   L+
Sbjct: 151 IQKDEETLK 159


>AY051513-1|AAK92937.1|  613|Drosophila melanogaster GH16590p
           protein.
          Length = 613

 Score = 37.1 bits (82), Expect = 0.024
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAK---CHACIGGTNVREDIRQL 451
           +E  AL+++PTRELA+QI +V+    +H + +       +GG ++ EDI  L
Sbjct: 81  KEIGALVISPTRELARQISEVLAQFLEHEDLEHLNQQLIVGGNSIEEDIATL 132



 Score = 35.1 bits (77), Expect = 0.098
 Identities = 17/55 (30%), Positives = 33/55 (60%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + D   L + +L+ + ++GF++ + +Q  AI   +  +DV A+A +G+GK L  L
Sbjct: 8   SLDKPPLSDAVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFL 62


>AE014297-721|AAF54208.1|  613|Drosophila melanogaster CG9630-PA
           protein.
          Length = 613

 Score = 37.1 bits (82), Expect = 0.024
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAK---CHACIGGTNVREDIRQL 451
           +E  AL+++PTRELA+QI +V+    +H + +       +GG ++ EDI  L
Sbjct: 81  KEIGALVISPTRELARQISEVLAQFLEHEDLEHLNQQLIVGGNSIEEDIATL 132



 Score = 35.1 bits (77), Expect = 0.098
 Identities = 17/55 (30%), Positives = 33/55 (60%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + D   L + +L+ + ++GF++ + +Q  AI   +  +DV A+A +G+GK L  L
Sbjct: 8   SLDKPPLSDAVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFL 62


>AY119628-1|AAM50282.1|  826|Drosophila melanogaster RE19835p
           protein.
          Length = 826

 Score = 36.7 bits (81), Expect = 0.032
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++ F    L ++  + +    F  P+ +Q+ +I P +QG+DV+  A +G+GK L  L
Sbjct: 71  IKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFL 127



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 16/39 (41%), Positives = 25/39 (64%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           A+I++PTRELA QI + +  +G H +      IGG N++
Sbjct: 147 AIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLK 185


>AE014298-2591|AAF48747.2|  826|Drosophila melanogaster CG5800-PA
           protein.
          Length = 826

 Score = 36.7 bits (81), Expect = 0.032
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++ F    L ++  + +    F  P+ +Q+ +I P +QG+DV+  A +G+GK L  L
Sbjct: 71  IKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFL 127



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 16/39 (41%), Positives = 25/39 (64%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           A+I++PTRELA QI + +  +G H +      IGG N++
Sbjct: 147 AIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLK 185


>AY058515-1|AAL13744.1|  680|Drosophila melanogaster LD21880p
           protein.
          Length = 680

 Score = 35.9 bits (79), Expect = 0.056
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+I+APTREL  QI K +      L  +     GGT + E I +L+
Sbjct: 42  AIIMAPTRELCMQIGKDIRKFSKSLGLRPVCVYGGTGISEQIAELK 87


>AF145609-1|AAD38584.1|  974|Drosophila melanogaster BcDNA.GH02833
           protein.
          Length = 974

 Score = 33.5 bits (73), Expect = 0.30
 Identities = 12/29 (41%), Positives = 23/29 (79%)
 Frame = +3

Query: 177 SAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +++QQ+ I   +QG+DV+ ++Q+G+GK L
Sbjct: 351 TSVQQKTIPEVLQGKDVLVRSQTGSGKTL 379


>AE014298-2568|AAO41693.1|  975|Drosophila melanogaster CG8611-PB,
           isoform B protein.
          Length = 975

 Score = 33.5 bits (73), Expect = 0.30
 Identities = 12/29 (41%), Positives = 23/29 (79%)
 Frame = +3

Query: 177 SAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +++QQ+ I   +QG+DV+ ++Q+G+GK L
Sbjct: 352 TSVQQKTIPEVLQGKDVLVRSQTGSGKTL 380


>AE014298-2567|AAF48727.2|  974|Drosophila melanogaster CG8611-PA,
           isoform A protein.
          Length = 974

 Score = 33.5 bits (73), Expect = 0.30
 Identities = 12/29 (41%), Positives = 23/29 (79%)
 Frame = +3

Query: 177 SAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +++QQ+ I   +QG+DV+ ++Q+G+GK L
Sbjct: 351 TSVQQKTIPEVLQGKDVLVRSQTGSGKTL 379


>AE014296-2963|AAF49303.1|  594|Drosophila melanogaster CG5589-PA
           protein.
          Length = 594

 Score = 32.7 bits (71), Expect = 0.52
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDT-SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 406
           +P  + KT  F   I+  +        +AL+LAPTRELAQQI +    L      + H
Sbjct: 163 APTGSGKTLAFLTPIINGLRAHKTTGLRALVLAPTRELAQQIYRECAELTRETGLRTH 220


>BT010296-1|AAQ23614.1|  813|Drosophila melanogaster LD11580p
           protein.
          Length = 813

 Score = 32.3 bits (70), Expect = 0.69
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           L+L PTRELA Q++  ++A   +   +  A  GG  V +  R L
Sbjct: 344 LVLTPTRELAVQVKNHLVAAAKYTGIRVAAIFGGLAVAKQERVL 387


>AE013599-2990|AAF57487.1|  813|Drosophila melanogaster CG9143-PA
           protein.
          Length = 813

 Score = 32.3 bits (70), Expect = 0.69
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           L+L PTRELA Q++  ++A   +   +  A  GG  V +  R L
Sbjct: 344 LVLTPTRELAVQVKNHLVAAAKYTGIRVAAIFGGLAVAKQERVL 387


>AY058512-1|AAL13741.1|  536|Drosophila melanogaster LD21669p
           protein.
          Length = 536

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 7/79 (8%)
 Frame = +2

Query: 206 LHPRTRCYRSSPVRNWKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQK 364
           +H    C  ++     KT T+ + I+ ++       +  +   + LIL P RELA QI  
Sbjct: 143 VHGNEHCLIAAETGCGKTITYLLPIVDKLLQKEVVTERKLNTPRVLILTPGRELATQIAG 202

Query: 365 VVIALGDHLNAKCHACIGG 421
           V   L    N K  + +GG
Sbjct: 203 VTEKLTQGTNLKVQSLLGG 221


>AE014134-152|AAF51458.1|  536|Drosophila melanogaster CG3561-PA
           protein.
          Length = 536

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 7/79 (8%)
 Frame = +2

Query: 206 LHPRTRCYRSSPVRNWKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQK 364
           +H    C  ++     KT T+ + I+ ++       +  +   + LIL P RELA QI  
Sbjct: 143 VHGNEHCLIAAETGCGKTITYLLPIVDKLLQKEVVTERKLNTPRVLILTPGRELATQIAG 202

Query: 365 VVIALGDHLNAKCHACIGG 421
           V   L    N K  + +GG
Sbjct: 203 VTEKLTQGTNLKVQSLLGG 221


>AE014298-2574|AAO41695.1| 1740|Drosophila melanogaster CG8557-PB,
           isoform B protein.
          Length = 1740

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 18/66 (27%), Positives = 26/66 (39%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSPPSEFVGPALLWEPGSKLDIHECL 297
           HH H HHS   ++LH H  H  +         Q+L   S F+G        +   +H   
Sbjct: 65  HHHHAHHSHHQQHLHQHHSHLSQRHQQQQQQQQQLQQTS-FIGSPPSSASITTAQLHSAF 123

Query: 296 YRFVVE 279
            R + E
Sbjct: 124 SRRIAE 129


>AE014298-1416|AAF46559.1| 1161|Drosophila melanogaster CG15311-PA
           protein.
          Length = 1161

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 14/36 (38%), Positives = 17/36 (47%)
 Frame = -3

Query: 488 PWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDH 381
           P   HH H HH   G++L  H  H   HG  H+  H
Sbjct: 708 PVKDHHHHHHH--SGQHLGNHHHHSHHHGYNHNGAH 741


>BT001389-1|AAN71144.1|  374|Drosophila melanogaster GH04919p
           protein.
          Length = 374

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = -3

Query: 482 SAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSPP--SEFVGPALLWEPGSKLDI 309
           S +H+H H +PV     G WC +  H +    ++ EL P        P +L+E    LD+
Sbjct: 252 SFYHLHVHINPVRNDAPGIWCEK-SHMLDTVINNLELMPDYYQRATLPFVLYEGNKLLDL 310

Query: 308 HE 303
           +E
Sbjct: 311 YE 312


>AE014297-342|AAF51960.1|  374|Drosophila melanogaster CG2091-PA
           protein.
          Length = 374

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = -3

Query: 482 SAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSPP--SEFVGPALLWEPGSKLDI 309
           S +H+H H +PV     G WC +  H +    ++ EL P        P +L+E    LD+
Sbjct: 252 SFYHLHVHINPVRNDAPGIWCEK-SHMLDTVINNLELMPDYYQRATLPFVLYEGNKLLDL 310

Query: 308 HE 303
           +E
Sbjct: 311 YE 312


>M25292-1|AAA17840.1|  397|Drosophila melanogaster dsx protein.
          Length = 397

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%)
 Frame = -3

Query: 479 AHHVHEHHSPVGEYL-HGHWCH 417
           AHHVH HH+  G +  HGH  H
Sbjct: 131 AHHVHAHHAHGGHHSHHGHVLH 152


>BT029258-1|ABK30895.1|  427|Drosophila melanogaster FI01107p
           protein.
          Length = 427

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%)
 Frame = -3

Query: 479 AHHVHEHHSPVGEYL-HGHWCH 417
           AHHVH HH+  G +  HGH  H
Sbjct: 131 AHHVHAHHAHGGHHSHHGHVLH 152


>AY060257-1|AAL25296.1|  427|Drosophila melanogaster GH08308p
           protein.
          Length = 427

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%)
 Frame = -3

Query: 479 AHHVHEHHSPVGEYL-HGHWCH 417
           AHHVH HH+  G +  HGH  H
Sbjct: 131 AHHVHAHHAHGGHHSHHGHVLH 152


>AE014297-676|AAF54168.2|  427|Drosophila melanogaster CG11094-PC,
           isoform C protein.
          Length = 427

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%)
 Frame = -3

Query: 479 AHHVHEHHSPVGEYL-HGHWCH 417
           AHHVH HH+  G +  HGH  H
Sbjct: 131 AHHVHAHHAHGGHHSHHGHVLH 152


>AE014297-675|AAN13385.1|  427|Drosophila melanogaster CG11094-PB,
           isoform B protein.
          Length = 427

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%)
 Frame = -3

Query: 479 AHHVHEHHSPVGEYL-HGHWCH 417
           AHHVH HH+  G +  HGH  H
Sbjct: 131 AHHVHAHHAHGGHHSHHGHVLH 152


>AE014297-674|AAF54169.1|  549|Drosophila melanogaster CG11094-PA,
           isoform A protein.
          Length = 549

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%)
 Frame = -3

Query: 479 AHHVHEHHSPVGEYL-HGHWCH 417
           AHHVH HH+  G +  HGH  H
Sbjct: 131 AHHVHAHHAHGGHHSHHGHVLH 152


>BT029931-1|ABM92805.1|  750|Drosophila melanogaster IP11737p
           protein.
          Length = 750

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 17/48 (35%), Positives = 21/48 (43%)
 Frame = -3

Query: 500 SYTRPWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSPPSE 357
           S+T P S  H   HHS    Y H H  HQ +    H + H    P S+
Sbjct: 676 SHTHPHSHPHHSSHHSHHTAYPHSHSHHQQQQP--HQAHHHHHLPYSK 721


>AY051923-1|AAK93347.1|  806|Drosophila melanogaster LD40758p
           protein.
          Length = 806

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +2

Query: 185 PATRNNALHPRTRCYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQK 364
           P      L P     R   V + KT   S  + Q ++ S+ EC+A++    +ELA+++ K
Sbjct: 724 PLITRVTLGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECRAILERYDQELAREVAK 783

Query: 365 V 367
           +
Sbjct: 784 I 784


>AE014297-3274|AAF56099.3|  806|Drosophila melanogaster CG4656-PA
           protein.
          Length = 806

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +2

Query: 185 PATRNNALHPRTRCYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQK 364
           P      L P     R   V + KT   S  + Q ++ S+ EC+A++    +ELA+++ K
Sbjct: 724 PLITRVTLGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECRAILERYDQELAREVAK 783

Query: 365 V 367
           +
Sbjct: 784 I 784


>AE013599-873|AAF58931.1|  466|Drosophila melanogaster CG12932-PA
           protein.
          Length = 466

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 17/48 (35%), Positives = 21/48 (43%)
 Frame = -3

Query: 500 SYTRPWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSPPSE 357
           S+T P S  H   HHS    Y H H  HQ +    H + H    P S+
Sbjct: 392 SHTHPHSHPHHSSHHSHHTAYPHSHSHHQQQQP--HQAHHHHHLPYSK 437


>DQ375985-1|ABD37876.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375981-1|ABD37872.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375980-1|ABD37871.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375979-1|ABD37870.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375974-1|ABD37865.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375973-1|ABD37864.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375971-1|ABD37862.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375970-1|ABD37861.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375969-1|ABD37860.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375967-1|ABD37858.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375964-1|ABD37855.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375961-1|ABD37852.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375960-1|ABD37851.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375959-1|ABD37850.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375958-1|ABD37849.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375951-1|ABD37842.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375945-1|ABD37836.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375944-1|ABD37835.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375943-1|ABD37834.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375942-1|ABD37833.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375941-1|ABD37832.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375939-1|ABD37830.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375938-1|ABD37829.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375936-1|ABD37827.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375934-1|ABD37825.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375931-1|ABD37822.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375930-1|ABD37821.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375929-1|ABD37820.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375927-1|ABD37818.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375926-1|ABD37817.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375924-1|ABD37815.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375920-1|ABD37811.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375919-1|ABD37810.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375914-1|ABD37805.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375910-1|ABD37801.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375909-1|ABD37800.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375903-1|ABD37794.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375902-1|ABD37793.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375901-1|ABD37792.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375899-1|ABD37790.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375898-1|ABD37789.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375896-1|ABD37787.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375893-1|ABD37784.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375891-1|ABD37782.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375890-1|ABD37781.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375889-1|ABD37780.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375887-1|ABD37778.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375884-1|ABD37775.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375882-1|ABD37773.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375880-1|ABD37771.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375879-1|ABD37770.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375875-1|ABD37766.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375873-1|ABD37764.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375871-1|ABD37762.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375870-1|ABD37761.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375868-1|ABD37759.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375867-1|ABD37758.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375860-1|ABD37751.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375859-1|ABD37750.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375854-1|ABD37745.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375849-1|ABD37740.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375848-1|ABD37739.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375845-1|ABD37736.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375844-1|ABD37735.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375843-1|ABD37734.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375841-1|ABD37732.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375836-1|ABD37727.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375835-1|ABD37726.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375833-1|ABD37724.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375829-1|ABD37720.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375827-1|ABD37718.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375824-1|ABD37715.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375822-1|ABD37713.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375820-1|ABD37711.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375819-1|ABD37710.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375818-1|ABD37709.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDRDHGHHHHGHDHDHDHDHGHDHGHHH 97


>DQ375815-1|ABD37706.1|  449|Drosophila melanogaster catsup protein
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>AY084126-1|AAL89864.1|  376|Drosophila melanogaster RE20606p
           protein.
          Length = 376

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 5/65 (7%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA F + IL ++     +  +   Q +I++PTRELA QI             K     G
Sbjct: 10  KTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYG 69

Query: 419 GTNVR 433
           GT+ R
Sbjct: 70  GTSFR 74


>AY058528-1|AAL13757.1|  449|Drosophila melanogaster LD23513p
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>AF216584-1|AAF37226.1|  449|Drosophila melanogaster seven
           transmembrane protein Catecholaminesup protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


>AE014134-3021|AAF53744.1|  449|Drosophila melanogaster CG10449-PA
           protein.
          Length = 449

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGH-WCHQCKHGI*HSSDH 381
           HH H+H    G + HGH   H   HG  H   H
Sbjct: 65  HHHHDHDHDHGHHHHGHDHDHDHDHGHDHGHHH 97


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,495,869
Number of Sequences: 53049
Number of extensions: 843614
Number of successful extensions: 4810
Number of sequences better than 10.0: 183
Number of HSP's better than 10.0 without gapping: 2977
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4251
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3252477558
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).