SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30048
         (717 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY052048-1|AAK93472.1|  537|Drosophila melanogaster LP06937p pro...    29   6.3  
AE014297-2561|AAN13783.1|  537|Drosophila melanogaster CG7702-PB...    29   6.3  
AE014297-2560|AAF55580.1|  537|Drosophila melanogaster CG7702-PA...    29   6.3  

>AY052048-1|AAK93472.1|  537|Drosophila melanogaster LP06937p
           protein.
          Length = 537

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 17  KMKVLLLCIAFAAVSLAMPVAEEKDVVPAQPILEV 121
           K K+LLL +A AA+ LA  V  + + +P QP+  +
Sbjct: 2   KHKLLLLFLAGAALLLATEVRSQHEDIPYQPVSNI 36


>AE014297-2561|AAN13783.1|  537|Drosophila melanogaster CG7702-PB,
           isoform B protein.
          Length = 537

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 17  KMKVLLLCIAFAAVSLAMPVAEEKDVVPAQPILEV 121
           K K+LLL +A AA+ LA  V  + + +P QP+  +
Sbjct: 2   KHKLLLLFLAGAALLLATEVRSQHEDIPYQPVSNI 36


>AE014297-2560|AAF55580.1|  537|Drosophila melanogaster CG7702-PA,
           isoform A protein.
          Length = 537

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +2

Query: 17  KMKVLLLCIAFAAVSLAMPVAEEKDVVPAQPILEV 121
           K K+LLL +A AA+ LA  V  + + +P QP+  +
Sbjct: 2   KHKLLLLFLAGAALLLATEVRSQHEDIPYQPVSNI 36


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,575,836
Number of Sequences: 53049
Number of extensions: 489572
Number of successful extensions: 1281
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1167
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1281
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3190721655
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).