SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT001686-1|AAN71441.1|  315|Drosophila melanogaster RE58223p pro...   133   3e-31
AE014297-246|AAF52032.1|  308|Drosophila melanogaster CG2663-PA,...   133   3e-31
AE014297-245|AAN13281.1|  315|Drosophila melanogaster CG2663-PB,...   133   3e-31
BT022706-1|AAY55122.1|  326|Drosophila melanogaster RH74717p pro...    62   6e-10
AE014297-4779|AAF57178.1|  298|Drosophila melanogaster CG11550-P...    62   6e-10
AE014134-1130|AAN10590.1|  313|Drosophila melanogaster CG31636-P...    57   3e-08
BT005203-1|AAO62632.1|  273|Drosophila melanogaster GH10582p pro...    54   3e-07
AE014297-3153|AAF55994.1|  273|Drosophila melanogaster CG13848-P...    54   3e-07
AY075483-1|AAL68293.1|  313|Drosophila melanogaster RE39480p pro...    52   1e-06
AE013599-905|AAF58912.1|  313|Drosophila melanogaster CG12926-PA...    52   1e-06
AE014296-195|ABC66124.1|  310|Drosophila melanogaster CG33966-PA...    51   2e-06
AE014297-3365|AAF56167.1|  311|Drosophila melanogaster CG10300-P...    50   3e-06
AY084181-1|AAL89919.1|  308|Drosophila melanogaster RE54230p pro...    48   2e-05
AE013599-900|AAM71078.1|  308|Drosophila melanogaster CG30339-PA...    48   2e-05
BT012303-1|AAS77428.1|  311|Drosophila melanogaster LP22879p pro...    47   3e-05
AY071631-1|AAL49253.1|  311|Drosophila melanogaster RE67755p pro...    47   3e-05
AE014296-833|AAX52731.1|  311|Drosophila melanogaster CG33514-PA...    47   3e-05
AE014296-194|ABC66123.1|  317|Drosophila melanogaster CG33965-PA...    47   3e-05
AE014297-3364|AAF56166.1|  353|Drosophila melanogaster CG10301-P...    42   0.001
BT011016-1|AAR30176.1|  303|Drosophila melanogaster RH61816p pro...    40   0.003
AE014298-371|AAF45762.1|  303|Drosophila melanogaster CG3091-PA,...    40   0.003
AY061455-1|AAL29003.1|  334|Drosophila melanogaster LD40136p pro...    39   0.007
AE014298-372|ABC67168.1|  135|Drosophila melanogaster CG3091-PB,...    39   0.007
AE014296-2147|AAF49914.2|  334|Drosophila melanogaster CG10657-P...    39   0.007
AY113341-1|AAM29346.1|  295|Drosophila melanogaster GH10083p pro...    39   0.009
AE014298-876|AAF46152.1|  295|Drosophila melanogaster CG3823-PA ...    39   0.009
AE014296-1011|AAF50745.1|  324|Drosophila melanogaster CG10546-P...    36   0.048
AY061588-1|AAL29136.1|  312|Drosophila melanogaster SD04017p pro...    36   0.064
AE013599-902|AAM71080.1|  312|Drosophila melanogaster CG1902-PC,...    36   0.064
AE013599-901|AAF58914.1|  312|Drosophila melanogaster CG1902-PA,...    36   0.064
AY129433-1|AAM76175.1|  311|Drosophila melanogaster HL01515p pro...    32   0.79 
AE014134-1279|AAN10631.1|  311|Drosophila melanogaster CG5973-PC...    32   0.79 
AE014134-1278|AAN10630.1|  311|Drosophila melanogaster CG5973-PB...    32   0.79 
AE014134-1277|AAF52517.2|  311|Drosophila melanogaster CG5973-PA...    32   0.79 
AY061823-1|AAL27634.1|  309|Drosophila melanogaster GH16463p pro...    31   2.4  
AL009195-6|CAA15707.1|  290|Drosophila melanogaster EG:30B8.3 pr...    31   2.4  
AE014298-370|AAF45761.2|  309|Drosophila melanogaster CG3191-PA ...    31   2.4  
AY051810-1|AAK93234.1|  421|Drosophila melanogaster LD32088p pro...    30   4.2  
AE014297-2412|AAF55471.1|  421|Drosophila melanogaster CG17806-P...    30   4.2  
AY119586-1|AAM50240.1|  719|Drosophila melanogaster LD15094p pro...    29   5.5  
AE014134-1672|AAF52796.1| 4345|Drosophila melanogaster CG15828-P...    29   5.5  
AE014134-1671|AAS64667.1| 4374|Drosophila melanogaster CG15828-P...    29   5.5  

>BT001686-1|AAN71441.1|  315|Drosophila melanogaster RE58223p
           protein.
          Length = 315

 Score =  133 bits (321), Expect = 3e-31
 Identities = 74/176 (42%), Positives = 105/176 (59%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLRGC FSLEK KKKLDMY+TMR A PEFF+NRD+ R EL  +L+    PTLPG+TP GR
Sbjct: 63  FLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGR 122

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           R+T  R +D +   + + D  K+A++       ++S   AGD+++LDAS+   +H  + F
Sbjct: 123 RITFIRGIDCDFQPHHILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAK-F 181

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEKSVF 779
           + +  +      ++      KE+HV   ISP V  + FN  K   +KEKI  +  F
Sbjct: 182 SPTVVKKFLIAVQEAYPVKVKEVHVI-NISPLVD-TIFNFVKPF-VKEKIRSRITF 234



 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 2/69 (2%)
 Frame = +1

Query: 100 LIQPSGELWKKIREELNE--DVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVAS 273
           ++ P+ +    IREEL E  D     +D+  I+EWL  QPHLP + +D  L TF      
Sbjct: 10  MLHPTPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKF 69

Query: 274 PLRNVKRNL 300
            L  VK+ L
Sbjct: 70  SLEKVKKKL 78


>AE014297-246|AAF52032.1|  308|Drosophila melanogaster CG2663-PA,
           isoform A protein.
          Length = 308

 Score =  133 bits (321), Expect = 3e-31
 Identities = 74/176 (42%), Positives = 105/176 (59%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLRGC FSLEK KKKLDMY+TMR A PEFF+NRD+ R EL  +L+    PTLPG+TP GR
Sbjct: 56  FLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGR 115

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           R+T  R +D +   + + D  K+A++       ++S   AGD+++LDAS+   +H  + F
Sbjct: 116 RITFIRGIDCDFQPHHILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAK-F 174

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEKSVF 779
           + +  +      ++      KE+HV   ISP V  + FN  K   +KEKI  +  F
Sbjct: 175 SPTVVKKFLIAVQEAYPVKVKEVHVI-NISPLVD-TIFNFVKPF-VKEKIRSRITF 227



 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 2/69 (2%)
 Frame = +1

Query: 100 LIQPSGELWKKIREELNE--DVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVAS 273
           ++ P+ +    IREEL E  D     +D+  I+EWL  QPHLP + +D  L TF      
Sbjct: 3   MLHPTPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKF 62

Query: 274 PLRNVKRNL 300
            L  VK+ L
Sbjct: 63  SLEKVKKKL 71


>AE014297-245|AAN13281.1|  315|Drosophila melanogaster CG2663-PB,
           isoform B protein.
          Length = 315

 Score =  133 bits (321), Expect = 3e-31
 Identities = 74/176 (42%), Positives = 105/176 (59%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLRGC FSLEK KKKLDMY+TMR A PEFF+NRD+ R EL  +L+    PTLPG+TP GR
Sbjct: 63  FLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGR 122

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           R+T  R +D +   + + D  K+A++       ++S   AGD+++LDAS+   +H  + F
Sbjct: 123 RITFIRGIDCDFQPHHILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAK-F 181

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEKSVF 779
           + +  +      ++      KE+HV   ISP V  + FN  K   +KEKI  +  F
Sbjct: 182 SPTVVKKFLIAVQEAYPVKVKEVHVI-NISPLVD-TIFNFVKPF-VKEKIRSRITF 234



 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 2/69 (2%)
 Frame = +1

Query: 100 LIQPSGELWKKIREELNE--DVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVAS 273
           ++ P+ +    IREEL E  D     +D+  I+EWL  QPHLP + +D  L TF      
Sbjct: 10  MLHPTPDQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKF 69

Query: 274 PLRNVKRNL 300
            L  VK+ L
Sbjct: 70  SLEKVKKKL 78


>BT022706-1|AAY55122.1|  326|Drosophila melanogaster RH74717p
           protein.
          Length = 326

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 32/83 (38%), Positives = 40/83 (48%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           F   C +S+E  K+ LD   T R    EFF N D  RPE+   +       LPG TP+G 
Sbjct: 74  FFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLDCERPEIRRAMRTVSIVPLPGATPEGY 133

Query: 432 RVTIARALDKNLDTNQLNDVFKL 500
           RV +A+  D N       DV KL
Sbjct: 134 RVILAKLDDLNTSNYNFADVMKL 156


>AE014297-4779|AAF57178.1|  298|Drosophila melanogaster CG11550-PA
           protein.
          Length = 298

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 32/83 (38%), Positives = 40/83 (48%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           F   C +S+E  K+ LD   T R    EFF N D  RPE+   +       LPG TP+G 
Sbjct: 46  FFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLDCERPEIRRAMRTVSIVPLPGATPEGY 105

Query: 432 RVTIARALDKNLDTNQLNDVFKL 500
           RV +A+  D N       DV KL
Sbjct: 106 RVILAKLDDLNTSNYNFADVMKL 128


>AE014134-1130|AAN10590.1|  313|Drosophila melanogaster CG31636-PA
           protein.
          Length = 313

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 36/119 (30%), Positives = 64/119 (53%), Gaps = 3/119 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDV-TRPELMDLLNRAQGPTLP-GLTPQ 425
           FLRG  FSLE+ K+K D ++T++ + PE F  R + T P+++D++       +P      
Sbjct: 55  FLRGTKFSLERAKEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDP 114

Query: 426 GRRVTIARALDKNLDTNQLNDVFKL-AMISEM*DCVKKSRE*AGDVYVLDASILMPSHL 599
           G RVTI RA   +   ++  D+ ++ +M  E+      +   +G V ++D + +  SHL
Sbjct: 115 GPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHL 173



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +1

Query: 142 ELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVK 291
           ELNE     AQD+ A+++W+ KQPHL    +D  L+ F       L   K
Sbjct: 18  ELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAK 67


>BT005203-1|AAO62632.1|  273|Drosophila melanogaster GH10582p
           protein.
          Length = 273

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/83 (39%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLR   F +E+ KKKL  ++ MRA   E+F NRD   PE+ DLL    G  LP G   + 
Sbjct: 51  FLRTSKFDVERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLK--LGVFLPIGPDAEQ 108

Query: 429 RRVTIARALDKNLDTNQLNDVFK 497
           R V + R    +   +  N+VFK
Sbjct: 109 RMVVVIRTAAHDPKLHSQNNVFK 131


>AE014297-3153|AAF55994.1|  273|Drosophila melanogaster CG13848-PA
           protein.
          Length = 273

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/83 (39%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLR   F +E+ KKKL  ++ MRA   E+F NRD   PE+ DLL    G  LP G   + 
Sbjct: 51  FLRTSKFDVERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLK--LGVFLPIGPDAEQ 108

Query: 429 RRVTIARALDKNLDTNQLNDVFK 497
           R V + R    +   +  N+VFK
Sbjct: 109 RMVVVIRTAAHDPKLHSQNNVFK 131


>AY075483-1|AAL68293.1|  313|Drosophila melanogaster RE39480p
           protein.
          Length = 313

 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLRGC +SLEK K KLD ++ MR A PE + NR V   +L  +L+      LP  L   G
Sbjct: 60  FLRGCKYSLEKTKLKLDNFYAMRGAMPELYKNRIVGEKQL-SILDTGCLLRLPQPLQADG 118

Query: 429 RRVTIAR 449
            R+ I+R
Sbjct: 119 PRIHISR 125



 Score = 37.5 bits (83), Expect = 0.021
 Identities = 20/63 (31%), Positives = 29/63 (46%)
 Frame = +1

Query: 112 SGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVK 291
           S EL KK  +EL E  +   +D+  ++ W+ KQPHL    +   L+ F       L   K
Sbjct: 13  SPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTK 72

Query: 292 RNL 300
             L
Sbjct: 73  LKL 75


>AE013599-905|AAF58912.1|  313|Drosophila melanogaster CG12926-PA
           protein.
          Length = 313

 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLRGC +SLEK K KLD ++ MR A PE + NR V   +L  +L+      LP  L   G
Sbjct: 60  FLRGCKYSLEKTKLKLDNFYAMRGAVPELYKNRIVGEKQL-SILDTGCLLRLPQPLQADG 118

Query: 429 RRVTIAR 449
            R+ I+R
Sbjct: 119 PRIHISR 125



 Score = 37.5 bits (83), Expect = 0.021
 Identities = 20/63 (31%), Positives = 29/63 (46%)
 Frame = +1

Query: 112 SGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVK 291
           S EL KK  +EL E  +   +D+  ++ W+ KQPHL    +   L+ F       L   K
Sbjct: 13  SPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTK 72

Query: 292 RNL 300
             L
Sbjct: 73  LKL 75


>AE014296-195|ABC66124.1|  310|Drosophila melanogaster CG33966-PA
           protein.
          Length = 310

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 2/133 (1%)
 Frame = +3

Query: 249 DFLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQ 425
           +FLRGC FSLE+ K K+D ++T+R   PEF+   +V   + +++        LP  L   
Sbjct: 54  NFLRGCKFSLERTKSKIDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDN 113

Query: 426 GRRVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*A-GDVYVLDASILMPSHLR 602
           G R+ + R    +     L +V + A + +     +       G + +LD S +   H  
Sbjct: 114 GPRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFL 173

Query: 603 QDFTSSAEEILSF 641
           Q   S A+++  F
Sbjct: 174 QMSPSFAKKMTVF 186



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +1

Query: 103 IQP-SGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPL 279
           I+P S EL K   E LNE  N    D+AA+++W+++QPHL    +D  L+ F       L
Sbjct: 4   IRPLSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSL 63

Query: 280 RNVKRNL 300
              K  +
Sbjct: 64  ERTKSKI 70


>AE014297-3365|AAF56167.1|  311|Drosophila melanogaster CG10300-PA
           protein.
          Length = 311

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 4/123 (3%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR C FS E+ K++ D Y+++R+  PE   +R V    L  L        +  ++P+G 
Sbjct: 56  FLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGP 115

Query: 432 RVTIARALDKNLDTNQLN--DVFKLAMIS-EM*DCVKKSRE*AGDVYVLDA-SILMPSHL 599
           RV I++   +N+D  + N  + FKL  I  E+      +   +G ++V+DA  + M   +
Sbjct: 116 RVIISQF--RNIDPKKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMM 173

Query: 600 RQD 608
           + D
Sbjct: 174 QYD 176



 Score = 37.9 bits (84), Expect = 0.016
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = +1

Query: 82  MASTATLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTF 255
           MA+T   + P  +L    + E NE+   RA+ +A IK W+ K PHL    ++  ++ F
Sbjct: 1   MANTLRTLDP--KLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAF 56


>AY084181-1|AAL89919.1|  308|Drosophila melanogaster RE54230p
           protein.
          Length = 308

 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 21/41 (51%), Positives = 26/41 (63%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELM 374
           FLRGC FSLEK K KLD ++T++   PE F  R V    L+
Sbjct: 55  FLRGCKFSLEKTKSKLDHFYTIKTLMPELFGKRLVDERNLI 95



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 25/69 (36%), Positives = 31/69 (44%)
 Frame = +1

Query: 94  ATLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVAS 273
           A L   S EL +    ELNE       DL A+++WL KQPHL    +D  L+ F      
Sbjct: 2   ANLRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKF 61

Query: 274 PLRNVKRNL 300
            L   K  L
Sbjct: 62  SLEKTKSKL 70


>AE013599-900|AAM71078.1|  308|Drosophila melanogaster CG30339-PA
           protein.
          Length = 308

 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 21/41 (51%), Positives = 26/41 (63%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELM 374
           FLRGC FSLEK K KLD ++T++   PE F  R V    L+
Sbjct: 55  FLRGCKFSLEKTKSKLDHFYTIKTLMPELFGKRLVDERNLI 95



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 25/69 (36%), Positives = 31/69 (44%)
 Frame = +1

Query: 94  ATLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVAS 273
           A L   S EL +    ELNE       DL A+++WL KQPHL    +D  L+ F      
Sbjct: 2   ANLRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKF 61

Query: 274 PLRNVKRNL 300
            L   K  L
Sbjct: 62  SLEKTKSKL 70


>BT012303-1|AAS77428.1|  311|Drosophila melanogaster LP22879p
           protein.
          Length = 311

 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 2/132 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLRGC +SLE+ K KLD Y+T++   P++F   + T  +  ++        LP  L   G
Sbjct: 56  FLRGCKYSLERAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENG 115

Query: 429 RRVTIARALDKNLDTNQLNDVFKLAM-ISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQ 605
            R+ I R     ++   + +  ++A  + E+           G V+++D      +HL Q
Sbjct: 116 PRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQ 175

Query: 606 DFTSSAEEILSF 641
              S A++   F
Sbjct: 176 MTPSMAKKFTVF 187



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 22/61 (36%), Positives = 28/61 (45%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRN 297
           EL K  +E+L ED      DL A K W+ +QPHL    +D  L+ F       L   K  
Sbjct: 11  ELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSK 70

Query: 298 L 300
           L
Sbjct: 71  L 71


>AY071631-1|AAL49253.1|  311|Drosophila melanogaster RE67755p
           protein.
          Length = 311

 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 33/121 (27%), Positives = 59/121 (48%), Gaps = 2/121 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR C FS E+ K++ D Y+++R+  PE   +R V    L  L        +  ++P+G 
Sbjct: 56  FLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGP 115

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMIS-EM*DCVKKSRE*AGDVYVLDA-SILMPSHLRQ 605
           RV I++    +   +   + FKL  I  E+      +   +G ++V+DA  + M   ++ 
Sbjct: 116 RVIISQFRYIDPKKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQY 175

Query: 606 D 608
           D
Sbjct: 176 D 176



 Score = 37.9 bits (84), Expect = 0.016
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = +1

Query: 82  MASTATLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTF 255
           MA+T   + P  +L    + E NE+   RA+ +A IK W+ K PHL    ++  ++ F
Sbjct: 1   MANTLRTLDP--KLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAF 56


>AE014296-833|AAX52731.1|  311|Drosophila melanogaster CG33514-PA
           protein.
          Length = 311

 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 2/132 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLRGC +SLE+ K KLD Y+T++   P++F   + T  +  ++        LP  L   G
Sbjct: 56  FLRGCKYSLERAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENG 115

Query: 429 RRVTIARALDKNLDTNQLNDVFKLAM-ISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQ 605
            R+ I R     ++   + +  ++A  + E+           G V+++D      +HL Q
Sbjct: 116 PRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQ 175

Query: 606 DFTSSAEEILSF 641
              S A++   F
Sbjct: 176 MTPSMAKKFTVF 187



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 22/61 (36%), Positives = 28/61 (45%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRN 297
           EL K  +E+L ED      DL A K W+ +QPHL    +D  L+ F       L   K  
Sbjct: 11  ELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSK 70

Query: 298 L 300
           L
Sbjct: 71  L 71


>AE014296-194|ABC66123.1|  317|Drosophila melanogaster CG33965-PA
           protein.
          Length = 317

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 31/112 (27%), Positives = 60/112 (53%), Gaps = 3/112 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFAN-RDVTRPELMDLLNRAQGPTLP-GLTPQ 425
           FLRG  FSLEK K+K+D +++++A  PE F + R V   ++++++       +P      
Sbjct: 60  FLRGSKFSLEKAKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLDEEDT 119

Query: 426 GRRVTIARALDKNLDTNQLNDVFKL-AMISEM*DCVKKSRE*AGDVYVLDAS 578
           G  VTI RA   +++  +  D+ ++ +M  E+      +   +G + ++D S
Sbjct: 120 GPAVTIIRAGSYDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMS 171



 Score = 46.4 bits (105), Expect = 5e-05
 Identities = 27/64 (42%), Positives = 35/64 (54%)
 Frame = +1

Query: 109 PSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMTFSEAVASPLRNV 288
           P G L K   EELNE  +    D+AA+KEWL+KQPHL    ED  L++F       L   
Sbjct: 13  PPG-LQKVAIEELNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKA 71

Query: 289 KRNL 300
           K+ +
Sbjct: 72  KQKI 75


>AE014297-3364|AAF56166.1|  353|Drosophila melanogaster CG10301-PA
           protein.
          Length = 353

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDL 380
           FLR C +SLE+ K+++D YFT     PE   NR VT+  L+D+
Sbjct: 100 FLRRCRYSLEETKRRIDRYFTHYNLFPEIMNNRCVTQ-RLLDI 141



 Score = 36.7 bits (81), Expect = 0.036
 Identities = 22/76 (28%), Positives = 34/76 (44%)
 Frame = +1

Query: 73  KSEMASTATLIQPSGELWKKIREELNEDVNTRAQDLAAIKEWLRKQPHLPDEWEDACLMT 252
           K  +A T      S  L K   +E+NE  +   QD+  ++ W+R+QPHL    +   L+ 
Sbjct: 40  KHRIAVTKMRRPLSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIA 99

Query: 253 FSEAVASPLRNVKRNL 300
           F       L   KR +
Sbjct: 100 FLRRCRYSLEETKRRI 115


>BT011016-1|AAR30176.1|  303|Drosophila melanogaster RH61816p
           protein.
          Length = 303

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 24/80 (30%), Positives = 39/80 (48%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL+  +F +E+ K   ++ + MR   P  F +R++      + L  +    LPG+TPQG 
Sbjct: 51  FLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGN 110

Query: 432 RVTIARALDKNLDTNQLNDV 491
           ++   R  D  LD    N V
Sbjct: 111 KLIFFRMAD--LDPRTRNSV 128


>AE014298-371|AAF45762.1|  303|Drosophila melanogaster CG3091-PA,
           isoform A protein.
          Length = 303

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 24/80 (30%), Positives = 39/80 (48%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL+  +F +E+ K   ++ + MR   P  F +R++      + L  +    LPG+TPQG 
Sbjct: 51  FLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGN 110

Query: 432 RVTIARALDKNLDTNQLNDV 491
           ++   R  D  LD    N V
Sbjct: 111 KLIFFRMAD--LDPRTRNSV 128


>AY061455-1|AAL29003.1|  334|Drosophila melanogaster LD40136p
           protein.
          Length = 334

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = +1

Query: 136 REELNEDVNTRAQDLAAIKEWLRKQPHL 219
           +EEL+ED N R Q LA  +EW+ K PH+
Sbjct: 40  KEELHEDENIRRQALAQFREWIEKHPHI 67



 Score = 37.1 bits (82), Expect = 0.028
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 3/112 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   FS+    + L+ Y T+R   P++F   D+  P + ++        LP     GR
Sbjct: 80  FLRTKKFSVPSACEMLERYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGR 139

Query: 432 RV--TIARALDKNLDTN-QLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDAS 578
           +V  ++A   D    T+ Q+  V  L   + + D   +  + AG VY+ D S
Sbjct: 140 QVIFSVAAKFDPYKFTSVQMARVHSLVCEALLDD---EDSQVAGYVYINDES 188


>AE014298-372|ABC67168.1|  135|Drosophila melanogaster CG3091-PB,
           isoform B protein.
          Length = 135

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL+  +F +E+ K   ++ + MR   P  F +R++      + L  +    LPG+TPQG 
Sbjct: 51  FLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGN 110

Query: 432 RVTIARALD 458
           ++   R  D
Sbjct: 111 KLIFFRMAD 119


>AE014296-2147|AAF49914.2|  334|Drosophila melanogaster CG10657-PA
           protein.
          Length = 334

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = +1

Query: 136 REELNEDVNTRAQDLAAIKEWLRKQPHL 219
           +EEL+ED N R Q LA  +EW+ K PH+
Sbjct: 40  KEELHEDENIRRQALAQFREWIEKHPHI 67



 Score = 37.1 bits (82), Expect = 0.028
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 3/112 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   FS+    + L+ Y T+R   P++F   D+  P + ++        LP     GR
Sbjct: 80  FLRTKKFSVPSACEMLERYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGR 139

Query: 432 RV--TIARALDKNLDTN-QLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDAS 578
           +V  ++A   D    T+ Q+  V  L   + + D   +  + AG VY+ D S
Sbjct: 140 QVIFSVAAKFDPYKFTSVQMARVHSLVCEALLDD---EDSQVAGYVYINDES 188


>AY113341-1|AAM29346.1|  295|Drosophila melanogaster GH10083p
           protein.
          Length = 295

 Score = 38.7 bits (86), Expect = 0.009
 Identities = 36/149 (24%), Positives = 61/149 (40%), Gaps = 4/149 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL      L   ++ L++ + +R      F +RD        LL  A    LPGLTP+  
Sbjct: 42  FLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENN 101

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DC----VKKSRE*AGDVYVLDASILMPSHL 599
           ++   R +D   D ++ N    + +   + DC      + R   G++ V D +     HL
Sbjct: 102 KLLFYRLID--FDADKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHL 159

Query: 600 RQDFTSSAEEILSFVYRKLIQ*NWKEIHV 686
            +    +    + FV ++      KEIHV
Sbjct: 160 TKTALGALRVYMKFV-QEAHPVRLKEIHV 187


>AE014298-876|AAF46152.1|  295|Drosophila melanogaster CG3823-PA
           protein.
          Length = 295

 Score = 38.7 bits (86), Expect = 0.009
 Identities = 36/149 (24%), Positives = 61/149 (40%), Gaps = 4/149 (2%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FL      L   ++ L++ + +R      F +RD        LL  A    LPGLTP+  
Sbjct: 42  FLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENN 101

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DC----VKKSRE*AGDVYVLDASILMPSHL 599
           ++   R +D   D ++ N    + +   + DC      + R   G++ V D +     HL
Sbjct: 102 KLLFYRLID--FDADKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHL 159

Query: 600 RQDFTSSAEEILSFVYRKLIQ*NWKEIHV 686
            +    +    + FV ++      KEIHV
Sbjct: 160 TKTALGALRVYMKFV-QEAHPVRLKEIHV 187


>AE014296-1011|AAF50745.1|  324|Drosophila melanogaster CG10546-PA
           protein.
          Length = 324

 Score = 36.3 bits (80), Expect = 0.048
 Identities = 21/71 (29%), Positives = 30/71 (42%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   FS+   ++ L  Y  +R   P      D   P L DL+++     +P     GR
Sbjct: 60  FLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGR 119

Query: 432 RVTIARALDKN 464
           RV +  A   N
Sbjct: 120 RVVVINAKGLN 130


>AY061588-1|AAL29136.1|  312|Drosophila melanogaster SD04017p
           protein.
          Length = 312

 Score = 35.9 bits (79), Expect = 0.064
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLR C + +E+ KK++  Y+T ++   E    R V   +L++L       TLP  + P G
Sbjct: 55  FLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVD-DKLIELARSGIFATLPKPIGPGG 113

Query: 429 RRVTIARALDKNLDTNQLNDVFK 497
            R+   R        + ++D+F+
Sbjct: 114 PRIHYTRMGHIEPSKHSVSDIFR 136


>AE013599-902|AAM71080.1|  312|Drosophila melanogaster CG1902-PC,
           isoform C protein.
          Length = 312

 Score = 35.9 bits (79), Expect = 0.064
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLR C + +E+ KK++  Y+T ++   E    R V   +L++L       TLP  + P G
Sbjct: 55  FLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVD-DKLIELARSGIFATLPKPIGPGG 113

Query: 429 RRVTIARALDKNLDTNQLNDVFK 497
            R+   R        + ++D+F+
Sbjct: 114 PRIHYTRMGHIEPSKHSVSDIFR 136


>AE013599-901|AAF58914.1|  312|Drosophila melanogaster CG1902-PA,
           isoform A protein.
          Length = 312

 Score = 35.9 bits (79), Expect = 0.064
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLP-GLTPQG 428
           FLR C + +E+ KK++  Y+T ++   E    R V   +L++L       TLP  + P G
Sbjct: 55  FLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVD-DKLIELARSGIFATLPKPIGPGG 113

Query: 429 RRVTIARALDKNLDTNQLNDVFK 497
            R+   R        + ++D+F+
Sbjct: 114 PRIHYTRMGHIEPSKHSVSDIFR 136


>AY129433-1|AAM76175.1|  311|Drosophila melanogaster HL01515p
           protein.
          Length = 311

 Score = 32.3 bits (70), Expect = 0.79
 Identities = 42/183 (22%), Positives = 81/183 (44%), Gaps = 7/183 (3%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMR----AACPEFFAN--RDVTRPELMDLLNRAQGPTLPG 413
           FLR   +  E   K+L  ++ M+    AAC     +  R+V    +++LL        P 
Sbjct: 79  FLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANILNLL--------PQ 130

Query: 414 LTPQGRRVTIARALDKNLDTN-QLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMP 590
               GRR+ +  A  K   +   L D+F+   ++ +   V+   +  G V ++D   L  
Sbjct: 131 RDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPL 190

Query: 591 SHLRQDFTSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEK 770
           SH+ Q   S A  +L ++ ++ I    K +H+    + ++    F + K   ++EK+ ++
Sbjct: 191 SHITQFTPSFAAMLLDYI-QECICMRLKAVHIVN--NSYIFNMLFAVFKPF-IREKLRKR 246

Query: 771 SVF 779
             F
Sbjct: 247 IFF 249


>AE014134-1279|AAN10631.1|  311|Drosophila melanogaster CG5973-PC,
           isoform C protein.
          Length = 311

 Score = 32.3 bits (70), Expect = 0.79
 Identities = 42/183 (22%), Positives = 81/183 (44%), Gaps = 7/183 (3%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMR----AACPEFFAN--RDVTRPELMDLLNRAQGPTLPG 413
           FLR   +  E   K+L  ++ M+    AAC     +  R+V    +++LL        P 
Sbjct: 79  FLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANILNLL--------PQ 130

Query: 414 LTPQGRRVTIARALDKNLDTN-QLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMP 590
               GRR+ +  A  K   +   L D+F+   ++ +   V+   +  G V ++D   L  
Sbjct: 131 RDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPL 190

Query: 591 SHLRQDFTSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEK 770
           SH+ Q   S A  +L ++ ++ I    K +H+    + ++    F + K   ++EK+ ++
Sbjct: 191 SHITQFTPSFAAMLLDYI-QECICMRLKAVHIVN--NSYIFNMLFAVFKPF-IREKLRKR 246

Query: 771 SVF 779
             F
Sbjct: 247 IFF 249


>AE014134-1278|AAN10630.1|  311|Drosophila melanogaster CG5973-PB,
           isoform B protein.
          Length = 311

 Score = 32.3 bits (70), Expect = 0.79
 Identities = 42/183 (22%), Positives = 81/183 (44%), Gaps = 7/183 (3%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMR----AACPEFFAN--RDVTRPELMDLLNRAQGPTLPG 413
           FLR   +  E   K+L  ++ M+    AAC     +  R+V    +++LL        P 
Sbjct: 79  FLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANILNLL--------PQ 130

Query: 414 LTPQGRRVTIARALDKNLDTN-QLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMP 590
               GRR+ +  A  K   +   L D+F+   ++ +   V+   +  G V ++D   L  
Sbjct: 131 RDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPL 190

Query: 591 SHLRQDFTSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEK 770
           SH+ Q   S A  +L ++ ++ I    K +H+    + ++    F + K   ++EK+ ++
Sbjct: 191 SHITQFTPSFAAMLLDYI-QECICMRLKAVHIVN--NSYIFNMLFAVFKPF-IREKLRKR 246

Query: 771 SVF 779
             F
Sbjct: 247 IFF 249


>AE014134-1277|AAF52517.2|  311|Drosophila melanogaster CG5973-PA,
           isoform A protein.
          Length = 311

 Score = 32.3 bits (70), Expect = 0.79
 Identities = 42/183 (22%), Positives = 81/183 (44%), Gaps = 7/183 (3%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMR----AACPEFFAN--RDVTRPELMDLLNRAQGPTLPG 413
           FLR   +  E   K+L  ++ M+    AAC     +  R+V    +++LL        P 
Sbjct: 79  FLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANILNLL--------PQ 130

Query: 414 LTPQGRRVTIARALDKNLDTN-QLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMP 590
               GRR+ +  A  K   +   L D+F+   ++ +   V+   +  G V ++D   L  
Sbjct: 131 RDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPL 190

Query: 591 SHLRQDFTSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEK 770
           SH+ Q   S A  +L ++ ++ I    K +H+    + ++    F + K   ++EK+ ++
Sbjct: 191 SHITQFTPSFAAMLLDYI-QECICMRLKAVHIVN--NSYIFNMLFAVFKPF-IREKLRKR 246

Query: 771 SVF 779
             F
Sbjct: 247 IFF 249


>AY061823-1|AAL27634.1|  309|Drosophila melanogaster GH16463p
           protein.
          Length = 309

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +3

Query: 264 CSFS-LEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRRVT 440
           C F  +E+ +K +++ + +R   P  F  RD    +     + A    LPGLTP   +V+
Sbjct: 66  CMFGDVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVS 125

Query: 441 I 443
           +
Sbjct: 126 L 126


>AL009195-6|CAA15707.1|  290|Drosophila melanogaster EG:30B8.3
           protein.
          Length = 290

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +3

Query: 264 CSFS-LEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRRVT 440
           C F  +E+ +K +++ + +R   P  F  RD    +     + A    LPGLTP   +V+
Sbjct: 66  CMFGDVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVS 125

Query: 441 I 443
           +
Sbjct: 126 L 126


>AE014298-370|AAF45761.2|  309|Drosophila melanogaster CG3191-PA
           protein.
          Length = 309

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +3

Query: 264 CSFS-LEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGRRVT 440
           C F  +E+ +K +++ + +R   P  F  RD    +     + A    LPGLTP   +V+
Sbjct: 66  CMFGDVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVS 125

Query: 441 I 443
           +
Sbjct: 126 L 126


>AY051810-1|AAK93234.1|  421|Drosophila melanogaster LD32088p
           protein.
          Length = 421

 Score = 29.9 bits (64), Expect = 4.2
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = +1

Query: 196 WLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRNLICTSR*GLLAQSSSRTET 354
           WLR QP +P     +CL+  ++A+A   R ++ N     + G   Q  S TET
Sbjct: 37  WLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQG--KQEDSDTET 87


>AE014297-2412|AAF55471.1|  421|Drosophila melanogaster CG17806-PA
           protein.
          Length = 421

 Score = 29.9 bits (64), Expect = 4.2
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = +1

Query: 196 WLRKQPHLPDEWEDACLMTFSEAVASPLRNVKRNLICTSR*GLLAQSSSRTET 354
           WLR QP +P     +CL+  ++A+A   R ++ N     + G   Q  S TET
Sbjct: 37  WLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQG--KQEDSDTET 87


>AY119586-1|AAM50240.1|  719|Drosophila melanogaster LD15094p
           protein.
          Length = 719

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 16/31 (51%), Positives = 16/31 (51%)
 Frame = -2

Query: 283 FSREKLQPRRKSSGTRLPTHLVDGVAFSATP 191
           FS  KLQP RK    R  T     VA SATP
Sbjct: 634 FSARKLQPERKYPIKRFATIFAKRVALSATP 664


>AE014134-1672|AAF52796.1| 4345|Drosophila melanogaster CG15828-PA,
            isoform A protein.
          Length = 4345

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 16/31 (51%), Positives = 16/31 (51%)
 Frame = -2

Query: 283  FSREKLQPRRKSSGTRLPTHLVDGVAFSATP 191
            FS  KLQP RK    R  T     VA SATP
Sbjct: 4260 FSARKLQPERKYPIKRFATIFAKRVALSATP 4290


>AE014134-1671|AAS64667.1| 4374|Drosophila melanogaster CG15828-PB,
            isoform B protein.
          Length = 4374

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 16/31 (51%), Positives = 16/31 (51%)
 Frame = -2

Query: 283  FSREKLQPRRKSSGTRLPTHLVDGVAFSATP 191
            FS  KLQP RK    R  T     VA SATP
Sbjct: 4289 FSARKLQPERKYPIKRFATIFAKRVALSATP 4319


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,611,354
Number of Sequences: 53049
Number of extensions: 833187
Number of successful extensions: 2419
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 2254
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2407
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3695805360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).