SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   186   3e-47
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   186   3e-47
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   186   3e-47
AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   186   3e-47
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   186   3e-47
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   186   3e-47
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   186   3e-47
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   186   3e-47
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   186   3e-47
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   184   1e-46
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   184   1e-46
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   184   1e-46
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   184   1e-46
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   184   1e-46
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   184   1e-46
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    184   1e-46
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   183   2e-46
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...   183   2e-46
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...   183   2e-46
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   183   2e-46
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   183   2e-46
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...   183   2e-46
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   183   2e-46
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   183   2e-46
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   183   2e-46
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...   183   2e-46
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...   148   6e-36
X06383-1|CAA29681.1|   84|Drosophila melanogaster protein ( Dros...   146   3e-35
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...   132   5e-31
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...   132   5e-31
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...   128   9e-30
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...   119   4e-27
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...   119   4e-27
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...   119   4e-27
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...    96   3e-20
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...    96   3e-20
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...    96   3e-20
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...    96   3e-20
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...    96   3e-20
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...    93   4e-19
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...    83   4e-16
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...    83   4e-16
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    57   2e-08
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    57   2e-08
L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related ...    38   0.016
AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p pro...    38   0.016
AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-P...    38   0.016
AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-P...    32   0.60 
AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P...    31   1.4  
AF195499-1|AAG28471.1|  397|Drosophila melanogaster Misexpressio...    29   4.2  
AE013599-3304|AAM71024.1|  275|Drosophila melanogaster CG30401-P...    29   4.2  
AE013599-3303|AAM71023.1|  377|Drosophila melanogaster CG30401-P...    29   4.2  
AY069512-1|AAL39657.1|  857|Drosophila melanogaster LD23217p pro...    29   5.6  
AE014298-1231|AAS65293.1| 1006|Drosophila melanogaster CG12075-P...    29   5.6  
AE014298-1230|AAF46414.3| 1006|Drosophila melanogaster CG12075-P...    29   5.6  
BT029638-1|ABL75697.1|   85|Drosophila melanogaster IP17177p pro...    29   7.4  
BT029611-1|ABL75670.1|   85|Drosophila melanogaster IP17077p pro...    29   7.4  
BT022484-1|AAY54900.1|  489|Drosophila melanogaster IP11785p pro...    29   7.4  
AY069429-1|AAL39574.1|  479|Drosophila melanogaster LD13887p pro...    29   7.4  
AE014296-1669|AAF50260.2|  783|Drosophila melanogaster CG32043-P...    29   7.4  
AE014296-1668|AAF50261.2|  783|Drosophila melanogaster CG32043-P...    29   7.4  
AE013599-140|AAF57285.3|  477|Drosophila melanogaster CG14593-PA...    29   7.4  
X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin prot...    28   9.8  
M13587-1|AAA28315.1|   12|Drosophila melanogaster protein ( D.me...    28   9.8  
AE014297-2186|AAF55298.2|  474|Drosophila melanogaster CG17929-P...    28   9.8  

>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  186 bits (452), Expect = 3e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  186 bits (452), Expect = 3e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  186 bits (452), Expect = 3e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  186 bits (452), Expect = 3e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  186 bits (452), Expect = 3e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  186 bits (452), Expect = 3e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  186 bits (452), Expect = 3e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  186 bits (452), Expect = 3e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  186 bits (452), Expect = 3e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNTPAMYVAIQAVLSLYASGRTTGI 152



 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  184 bits (447), Expect = 1e-46
 Identities = 82/85 (96%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  140 bits (338), Expect = 2e-33
 Identities = 63/71 (88%), Positives = 66/71 (92%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEG+ALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERG 198


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  184 bits (447), Expect = 1e-46
 Identities = 82/85 (96%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  140 bits (338), Expect = 2e-33
 Identities = 63/71 (88%), Positives = 66/71 (92%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEG+ALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERG 198


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  184 bits (447), Expect = 1e-46
 Identities = 82/85 (96%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  144 bits (350), Expect = 7e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  184 bits (447), Expect = 1e-46
 Identities = 82/85 (96%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 52  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 111

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 112 FNSPAMYVAIQAVLSLYASGRTTGI 136



 Score =  113 bits (271), Expect = 3e-25
 Identities = 52/55 (94%), Positives = 52/55 (94%)
 Frame = +1

Query: 103 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTP 267
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT   P
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 55



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 137 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 182


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  184 bits (447), Expect = 1e-46
 Identities = 82/85 (96%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  140 bits (338), Expect = 2e-33
 Identities = 63/71 (88%), Positives = 66/71 (92%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEG+ALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERG 198


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  184 bits (447), Expect = 1e-46
 Identities = 82/85 (96%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  144 bits (350), Expect = 7e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  184 bits (447), Expect = 1e-46
 Identities = 82/85 (96%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  140 bits (338), Expect = 2e-33
 Identities = 63/71 (88%), Positives = 66/71 (92%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEG+ALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERG 198


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNAPAMYVAIQAVLSLYASGRTTGI 152



 Score =  144 bits (350), Expect = 7e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  139 bits (337), Expect = 3e-33
 Identities = 64/71 (90%), Positives = 66/71 (92%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGIL+   P
Sbjct: 61  SKRGILSLKYP 71



 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGR LTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRHLTDYLMKILTERG 198


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  139 bits (337), Expect = 3e-33
 Identities = 64/71 (90%), Positives = 66/71 (92%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGIL+   P
Sbjct: 61  SKRGILSLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNAPAMYVAIQAVLSLYASGRTTGI 152



 Score =  144 bits (350), Expect = 7e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNAPAMYVAIQAVLSLYASGRTTGI 152



 Score =  144 bits (350), Expect = 7e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  139 bits (337), Expect = 3e-33
 Identities = 64/71 (90%), Positives = 66/71 (92%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGIL+   P
Sbjct: 61  SKRGILSLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNAPAMYVAIQAVLSLYASGRTTGI 152



 Score =  144 bits (350), Expect = 7e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNAPAMYVAIQAVLSLYASGRTTGI 152



 Score =  144 bits (350), Expect = 7e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNAPAMYVAIQAVLSLYASGRTTGI 152



 Score =  144 bits (350), Expect = 7e-35
 Identities = 67/71 (94%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNSPAMYVAIQAVLSLYASGRTTGI 152



 Score =  139 bits (337), Expect = 3e-33
 Identities = 64/71 (90%), Positives = 66/71 (92%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDEAQ
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGIL+   P
Sbjct: 61  SKRGILSLKYP 71



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score =  148 bits (359), Expect = 6e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = +3

Query: 300 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 479
           MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLS
Sbjct: 48  MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLS 107

Query: 480 LYASGRTTGM 509
           LYASGRTTG+
Sbjct: 108 LYASGRTTGI 117



 Score =  105 bits (252), Expect = 5e-23
 Identities = 53/86 (61%), Positives = 64/86 (74%), Gaps = 4/86 (4%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--KDSYVGD- 225
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM +    ++  + 
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMEKIWHHTFYNEL 60

Query: 226 -EAQSKRGILTSNTPSNTESSLTGMT 300
             A  +  +L +  P N +++   MT
Sbjct: 61  RVAPEEHPVLLTEAPLNPKANREKMT 86



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 118 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 163


>X06383-1|CAA29681.1|   84|Drosophila melanogaster protein (
           Drosophila 5C actingene exon 2 and exon 3 (part.). ).
          Length = 84

 Score =  146 bits (353), Expect = 3e-35
 Identities = 68/71 (95%), Positives = 68/71 (95%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDME 305
           LKYPIEHGIVTNWDDME
Sbjct: 68  LKYPIEHGIVTNWDDME 84


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score =  132 bits (318), Expect = 5e-31
 Identities = 60/85 (70%), Positives = 68/85 (80%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NREKMT+IMFE 
Sbjct: 65  LKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEH 123

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA YVA+QAVLSLYA+GRT G+
Sbjct: 124 FQVPAFYVAVQAVLSLYATGRTVGI 148



 Score = 87.0 bits (206), Expect = 2e-17
 Identities = 40/65 (61%), Positives = 49/65 (75%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+ A  KRGIL
Sbjct: 4   AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 63

Query: 253 TSNTP 267
           T   P
Sbjct: 64  TLKYP 68



 Score = 85.4 bits (202), Expect = 6e-17
 Identities = 37/46 (80%), Positives = 43/46 (93%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEG+ALPHA +R+DLAGRDLTDYL K+L ERG
Sbjct: 149 VVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERG 194


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score =  132 bits (318), Expect = 5e-31
 Identities = 60/85 (70%), Positives = 68/85 (80%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NREKMT+IMFE 
Sbjct: 73  LKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEH 131

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA YVA+QAVLSLYA+GRT G+
Sbjct: 132 FQVPAFYVAVQAVLSLYATGRTVGI 156



 Score = 87.0 bits (206), Expect = 2e-17
 Identities = 40/65 (61%), Positives = 49/65 (75%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+ A  KRGIL
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGIL 71

Query: 253 TSNTP 267
           T   P
Sbjct: 72  TLKYP 76



 Score = 85.4 bits (202), Expect = 6e-17
 Identities = 37/46 (80%), Positives = 43/46 (93%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEG+ALPHA +R+DLAGRDLTDYL K+L ERG
Sbjct: 157 VVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERG 202


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  128 bits (308), Expect = 9e-30
 Identities = 60/95 (63%), Positives = 70/95 (73%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 404
           R  E++    LKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NR
Sbjct: 63  RQPEKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNR 121

Query: 405 EKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           EKMT+IMFE F  PA YVA+QAVLSL  +GRT G+
Sbjct: 122 EKMTEIMFEHFQVPAFYVAVQAVLSLCTTGRTVGI 156



 Score = 85.8 bits (203), Expect = 5e-17
 Identities = 39/65 (60%), Positives = 48/65 (73%)
 Frame = +1

Query: 73  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+    KRGIL
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGERQPEKRGIL 71

Query: 253 TSNTP 267
           T   P
Sbjct: 72  TLKYP 76



 Score = 85.4 bits (202), Expect = 6e-17
 Identities = 37/46 (80%), Positives = 43/46 (93%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEG+ALPHA +R+DLAGRDLTDYL K+L ERG
Sbjct: 157 VVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERG 202


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  119 bits (286), Expect = 4e-27
 Identities = 52/96 (54%), Positives = 71/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ N
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           REK  +  FE  N PA++V++QAVLSLYA+GR TG+
Sbjct: 121 REKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGV 156



 Score = 72.5 bits (170), Expect = 5e-13
 Identities = 29/46 (63%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD+T YL  ++   G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREG 202



 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 30/63 (47%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+  RG+L+ 
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score =  119 bits (286), Expect = 4e-27
 Identities = 52/96 (54%), Positives = 71/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ N
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           REK  +  FE  N PA++V++QAVLSLYA+GR TG+
Sbjct: 121 REKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGV 156



 Score = 72.5 bits (170), Expect = 5e-13
 Identities = 29/46 (63%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD+T YL  ++   G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREG 202



 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 30/63 (47%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+  RG+L+ 
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score =  119 bits (286), Expect = 4e-27
 Identities = 52/96 (54%), Positives = 71/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ N
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           REK  +  FE  N PA++V++QAVLSLYA+GR TG+
Sbjct: 121 REKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGV 156



 Score = 72.5 bits (170), Expect = 5e-13
 Identities = 29/46 (63%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD+T YL  ++   G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREG 202



 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 30/63 (47%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG +A+  RG+L+ 
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 42/79 (53%), Positives = 54/79 (68%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFET
Sbjct: 74  IKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133

Query: 435 FNTPAMYVAIQAVLSLYAS 491
           FN P +Y+A+QAVL+L AS
Sbjct: 134 FNVPGLYIAVQAVLALAAS 152



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 19/45 (42%), Positives = 30/45 (66%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+  +P+ EGY +   I  + +AGR++T  +  +L ER
Sbjct: 167 VVDSGDGVTDVIPVAEGYVIGSCIKHIPIAGRNITSLIQSLLRER 211



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 8/65 (12%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 231
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 232 QSKRG 246
             + G
Sbjct: 67  FDRTG 71


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 41/87 (47%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 428
           ++ YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NREKM ++MF
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMF 128

Query: 429 ETFNTPAMYVAIQAVLSLYASGRTTGM 509
           E +   + Y+AIQAVL+LYA G  +G+
Sbjct: 129 EKYGFDSAYIAIQAVLTLYAQGLISGV 155



 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 29/46 (63%), Positives = 37/46 (80%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H  P+YE +ALPH   RLD+AGRD+T YL+K+L  RG
Sbjct: 156 VIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRG 201



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEAQSKRGIL 252
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA   R +L
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 253 TSNTP 267
             + P
Sbjct: 69  EVSYP 73


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 42/79 (53%), Positives = 54/79 (68%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFET
Sbjct: 74  IKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133

Query: 435 FNTPAMYVAIQAVLSLYAS 491
           FN P +Y+A+QAVL+L AS
Sbjct: 134 FNVPGLYIAVQAVLALAAS 152



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/45 (44%), Positives = 32/45 (71%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGR++T ++  +L ER
Sbjct: 167 VVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLRER 211



 Score = 37.1 bits (82), Expect = 0.021
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 8/65 (12%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 231
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 232 QSKRG 246
               G
Sbjct: 67  FDATG 71


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 41/87 (47%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 428
           ++ YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NREKM ++MF
Sbjct: 69  EVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMF 128

Query: 429 ETFNTPAMYVAIQAVLSLYASGRTTGM 509
           E +   + Y+AIQAVL+LYA G  +G+
Sbjct: 129 EKYGFDSAYIAIQAVLTLYAQGLISGV 155



 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 29/46 (63%), Positives = 37/46 (80%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H  P+YE +ALPH   RLD+AGRD+T YL+K+L  RG
Sbjct: 156 VIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRG 201



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEAQSKRGIL 252
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA   R +L
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 68

Query: 253 TSNTP 267
             + P
Sbjct: 69  EVSYP 73


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 42/79 (53%), Positives = 54/79 (68%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFET
Sbjct: 74  IKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133

Query: 435 FNTPAMYVAIQAVLSLYAS 491
           FN P +Y+A+QAVL+L AS
Sbjct: 134 FNVPGLYIAVQAVLALAAS 152



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/45 (44%), Positives = 32/45 (71%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGR++T ++  +L ER
Sbjct: 167 VVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLRER 211



 Score = 37.1 bits (82), Expect = 0.021
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 8/65 (12%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 231
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 232 QSKRG 246
               G
Sbjct: 67  FDATG 71


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score = 92.7 bits (220), Expect = 4e-19
 Identities = 39/87 (44%), Positives = 59/87 (67%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 428
           ++ YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NREKM ++MF
Sbjct: 70  EVSYPMENGVVRNWDDMCHVWEYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMF 129

Query: 429 ETFNTPAMYVAIQAVLSLYASGRTTGM 509
           E +   + Y+AIQA  +LYA G  +G+
Sbjct: 130 EKYGFDSAYIAIQAAWTLYAQGLISGV 156



 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 29/46 (63%), Positives = 37/46 (80%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H  P+YE +ALPH   RLD+AGRD+T YL+K+L  RG
Sbjct: 157 VIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRG 202



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDEAQSKRGIL 252
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDEA   R +L
Sbjct: 10  IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLL 69

Query: 253 TSNTP 267
             + P
Sbjct: 70  EVSYP 74


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score = 82.6 bits (195), Expect = 4e-16
 Identities = 34/81 (41%), Positives = 55/81 (67%)
 Frame = +3

Query: 267 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           ++ G++ NWD  EK+  + + N ++  PE HPVL +EA  N + NREK+T++MFE +N P
Sbjct: 93  MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTELMFEKYNVP 152

Query: 447 AMYVAIQAVLSLYASGRTTGM 509
           A ++   AVL+ ++SGR T +
Sbjct: 153 AFFLVKNAVLAAFSSGRATAL 173



 Score = 37.5 bits (83), Expect = 0.016
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44



 Score = 32.7 bits (71), Expect = 0.45
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG   +  VP++EGY L  A+++  L G  L+    + L + G
Sbjct: 174 VVDSGATHTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCRQHLEKHG 219


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score = 82.6 bits (195), Expect = 4e-16
 Identities = 34/81 (41%), Positives = 55/81 (67%)
 Frame = +3

Query: 267 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           ++ G++ NWD  EK+  + + N ++  PE HPVL +EA  N + NREK+T++MFE +N P
Sbjct: 93  MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTELMFEKYNVP 152

Query: 447 AMYVAIQAVLSLYASGRTTGM 509
           A ++   AVL+ ++SGR T +
Sbjct: 153 AFFLVKNAVLAAFSSGRATAL 173



 Score = 37.5 bits (83), Expect = 0.016
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44



 Score = 32.7 bits (71), Expect = 0.45
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSG   +  VP++EGY L  A+++  L G  L+    + L + G
Sbjct: 174 VVDSGATHTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCRQHLEKHG 219


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 428
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 429 ETFNTPAMYVAIQAVLS 479
           E +  P++   I A+ S
Sbjct: 139 ECYGIPSVSYGIDALYS 155



 Score = 31.5 bits (68), Expect = 1.0
 Identities = 17/68 (25%), Positives = 29/68 (42%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           LV+DNGS  C+ G++    P   F +++ +PR          + S      +    I   
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVG 66

Query: 259 NTPSNTES 282
           N  +N E+
Sbjct: 67  NDITNIEA 74


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 428
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 429 ETFNTPAMYVAIQAVLS 479
           E +  P++   I A+ S
Sbjct: 139 ECYGIPSVSYGIDALYS 155



 Score = 31.5 bits (68), Expect = 1.0
 Identities = 17/68 (25%), Positives = 29/68 (42%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           LV+DNGS  C+ G++    P   F +++ +PR          + S      +    I   
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVG 66

Query: 259 NTPSNTES 282
           N  +N E+
Sbjct: 67  NDITNIEA 74


>L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related
           protein protein.
          Length = 398

 Score = 37.5 bits (83), Expect = 0.016
 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 270 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 447 AMYVAIQAVLSLY 485
            +Y    A L+ +
Sbjct: 124 GVYKTTAADLAAF 136



 Score = 33.5 bits (73), Expect = 0.26
 Identities = 15/52 (28%), Positives = 29/52 (55%)
 Frame = +2

Query: 488 VRSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           + S +  ++D G   +H VP   G  +   I R+D+ G+ LT+ L ++++ R
Sbjct: 148 MESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYR 199


>AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p
           protein.
          Length = 398

 Score = 37.5 bits (83), Expect = 0.016
 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 270 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 447 AMYVAIQAVLSLY 485
            +Y    A L+ +
Sbjct: 124 GVYKTTAADLAAF 136



 Score = 33.5 bits (73), Expect = 0.26
 Identities = 15/52 (28%), Positives = 29/52 (55%)
 Frame = +2

Query: 488 VRSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           + S +  ++D G   +H VP   G  +   I R+D+ G+ LT+ L ++++ R
Sbjct: 148 MESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYR 199


>AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-PA
           protein.
          Length = 398

 Score = 37.5 bits (83), Expect = 0.016
 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 270 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 446
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 447 AMYVAIQAVLSLY 485
            +Y    A L+ +
Sbjct: 124 GVYKTTAADLAAF 136



 Score = 33.5 bits (73), Expect = 0.26
 Identities = 15/52 (28%), Positives = 29/52 (55%)
 Frame = +2

Query: 488 VRSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           + S +  ++D G   +H VP   G  +   I R+D+ G+ LT+ L ++++ R
Sbjct: 148 MESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYR 199


>AE013599-3087|AAM68186.2|   36|Drosophila melanogaster
          CG10067-PB, isoform B protein.
          Length = 36

 Score = 32.3 bits (70), Expect = 0.60
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +1

Query: 55 MCDEEVAALVVDNGS 99
          MCD+EVAALVVDNG+
Sbjct: 1  MCDDEVAALVVDNGA 15


>AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB
             protein.
          Length = 23015

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = -1

Query: 304   SMSSQLVTIPCSMGYLRSGYLFCSV--PRLLR--TSLSVPCRPS 185
             S+++ L T  C +GY    Y +C V  P+L    T  S PCRPS
Sbjct: 12906 SVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPS 12949



 Score = 29.5 bits (63), Expect = 4.2
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -1

Query: 295   SQLVTIPCSMGYLRSGYLFCSV-PRLLRTSLSVPCRPS 185
             + L T  C  GY+   Y +CS+ P+ +R  ++ PC+PS
Sbjct: 16119 NHLPTCNCLSGYVGDPYRYCSIEPKPIREYVN-PCQPS 16155


>AF195499-1|AAG28471.1|  397|Drosophila melanogaster Misexpression
           suppressor of ras 6 protein.
          Length = 397

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +3

Query: 489 SGRTTGMCWTPATVSPTPYPSTRDTH 566
           S  TT MCW+ +T +  P PS  + H
Sbjct: 29  SSTTTTMCWSSSTAALPPAPSAAEQH 54


>AE013599-3304|AAM71024.1|  275|Drosophila melanogaster CG30401-PA,
           isoform A protein.
          Length = 275

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = -1

Query: 505 PVVRPDAYSESTAWMATYMAGVLN 434
           P+V PD+  + +AW+  + AG+LN
Sbjct: 154 PMVSPDSEQQMSAWLHIFNAGILN 177


>AE013599-3303|AAM71023.1|  377|Drosophila melanogaster CG30401-PB,
           isoform B protein.
          Length = 377

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = -1

Query: 505 PVVRPDAYSESTAWMATYMAGVLN 434
           P+V PD+  + +AW+  + AG+LN
Sbjct: 256 PMVSPDSEQQMSAWLHIFNAGILN 279


>AY069512-1|AAL39657.1|  857|Drosophila melanogaster LD23217p
           protein.
          Length = 857

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 11/22 (50%), Positives = 12/22 (54%)
 Frame = +1

Query: 571 SRHPASGLGRSRPHRLPHEDPH 636
           SR P  G  +S PH  PH  PH
Sbjct: 85  SRSPPHGNSKSHPHAHPHHPPH 106


>AE014298-1231|AAS65293.1| 1006|Drosophila melanogaster CG12075-PB,
           isoform B protein.
          Length = 1006

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 11/22 (50%), Positives = 12/22 (54%)
 Frame = +1

Query: 571 SRHPASGLGRSRPHRLPHEDPH 636
           SR P  G  +S PH  PH  PH
Sbjct: 234 SRSPPHGNSKSHPHAHPHHPPH 255


>AE014298-1230|AAF46414.3| 1006|Drosophila melanogaster CG12075-PA,
           isoform A protein.
          Length = 1006

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 11/22 (50%), Positives = 12/22 (54%)
 Frame = +1

Query: 571 SRHPASGLGRSRPHRLPHEDPH 636
           SR P  G  +S PH  PH  PH
Sbjct: 234 SRSPPHGNSKSHPHAHPHHPPH 255


>BT029638-1|ABL75697.1|   85|Drosophila melanogaster IP17177p
           protein.
          Length = 85

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +1

Query: 460 PSKPCSRCTRPVVPPVC 510
           P+ PC R T P  PP+C
Sbjct: 66  PTTPCLRSTHPATPPLC 82


>BT029611-1|ABL75670.1|   85|Drosophila melanogaster IP17077p
           protein.
          Length = 85

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +1

Query: 460 PSKPCSRCTRPVVPPVC 510
           P+ PC R T P  PP+C
Sbjct: 66  PTTPCLRSTHPATPPLC 82


>BT022484-1|AAY54900.1|  489|Drosophila melanogaster IP11785p
           protein.
          Length = 489

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = -1

Query: 607 VATGQVQTQDGVRECVSLVDGYGVGDTVAGVQHIPVV-RPDAYSESTAWMATYMAGVLNV 431
           +ATGQ   Q+  +E ++L  G+        V ++PV+ RP+ Y  +  +   ++ GVL  
Sbjct: 30  LATGQGLEQE--QEGLALDMGHNASADGGIVPYVPVLDRPETYIVTVLYTLIFIVGVLGN 87

Query: 430 SNMIWVIF 407
             ++ + F
Sbjct: 88  GTLVIIFF 95


>AY069429-1|AAL39574.1|  479|Drosophila melanogaster LD13887p
           protein.
          Length = 479

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +1

Query: 559 IRTPSRHPASGLGRSRPHRLPHEDPH 636
           ++ P  HP      S PH LPH  PH
Sbjct: 335 LQHPHTHPHPHAQHSHPHTLPHSLPH 360


>AE014296-1669|AAF50260.2|  783|Drosophila melanogaster CG32043-PB,
           isoform B protein.
          Length = 783

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +1

Query: 559 IRTPSRHPASGLGRSRPHRLPHEDPH 636
           ++ P  HP      S PH LPH  PH
Sbjct: 639 LQHPHTHPHPHAQHSHPHTLPHSLPH 664


>AE014296-1668|AAF50261.2|  783|Drosophila melanogaster CG32043-PA,
           isoform A protein.
          Length = 783

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +1

Query: 559 IRTPSRHPASGLGRSRPHRLPHEDPH 636
           ++ P  HP      S PH LPH  PH
Sbjct: 639 LQHPHTHPHPHAQHSHPHTLPHSLPH 664


>AE013599-140|AAF57285.3|  477|Drosophila melanogaster CG14593-PA
           protein.
          Length = 477

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = -1

Query: 607 VATGQVQTQDGVRECVSLVDGYGVGDTVAGVQHIPVV-RPDAYSESTAWMATYMAGVLNV 431
           +ATGQ   Q+  +E ++L  G+        V ++PV+ RP+ Y  +  +   ++ GVL  
Sbjct: 30  LATGQGLEQE--QEGLALDMGHNASADGGIVPYVPVLDRPETYIVTVLYTLIFIVGVLGN 87

Query: 430 SNMIWVIF 407
             ++ + F
Sbjct: 88  GTLVIIFF 95


>X05176-1|CAA28809.1|   12|Drosophila melanogaster 42A actin
          protein.
          Length = 12

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 55 MCDEEVAALVVD 90
          MCDEEVAALVVD
Sbjct: 1  MCDEEVAALVVD 12


>M13587-1|AAA28315.1|   12|Drosophila melanogaster protein (
          D.melanogaster actin5C gene, 5' flank. ).
          Length = 12

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 55 MCDEEVAALVVD 90
          MCDEEVAALVVD
Sbjct: 1  MCDEEVAALVVD 12


>AE014297-2186|AAF55298.2|  474|Drosophila melanogaster CG17929-PA
           protein.
          Length = 474

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 4/65 (6%)
 Frame = -1

Query: 553 VDGYGVG-DTVAGVQHIPVVRPDAYSE---STAWMATYMAGVLNVSNMIWVIFSLLALGL 386
           V G G+G  TV  + H   V  D +      T W+    A V  V  +I ++FS++ LG+
Sbjct: 145 VAGAGIGLITVPFLIHSAEVATDNHRGVIYDTQWVDDKEASVNEVHGIIGIVFSIIGLGM 204

Query: 385 RGASV 371
              S+
Sbjct: 205 TALSI 209


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,273,777
Number of Sequences: 53049
Number of extensions: 843565
Number of successful extensions: 3381
Number of sequences better than 10.0: 65
Number of HSP's better than 10.0 without gapping: 2947
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3357
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2827453950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).