SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF034971-1|AAC62117.1|  268|Drosophila melanogaster ribosomal pr...   147   1e-35
AE014135-5|AAN06541.1|  218|Drosophila melanogaster CG2168-PB, i...   147   1e-35
AE014135-4|AAF59372.1|  268|Drosophila melanogaster CG2168-PA, i...   147   1e-35
Y10115-1|CAA71201.1|  270|Drosophila melanogaster ribosomal prot...   141   9e-34
AY070949-1|AAL48571.1|  217|Drosophila melanogaster RE04220p pro...   140   2e-33
AE014135-6|AAN06542.1|  163|Drosophila melanogaster CG2168-PD, i...   130   2e-30

>AF034971-1|AAC62117.1|  268|Drosophila melanogaster ribosomal
           protein S3a protein.
          Length = 268

 Score =  147 bits (356), Expect = 1e-35
 Identities = 71/104 (68%), Positives = 81/104 (77%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VLCNFHGMDLTTDK R MVKKWQTLIEA ++ KT DGY+LRVFCIGFT KD  SQRKTCY
Sbjct: 99  VLCNFHGMDLTTDKYRSMVKKWQTLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCY 158

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           AQ +QVR IR +M +IIT +V+ +D  +       DSIAKDIEK
Sbjct: 159 AQQSQVRKIRARMTDIITNEVSGADLKQLVNKLALDSIAKDIEK 202



 Score =  140 bits (339), Expect = 2e-33
 Identities = 67/84 (79%), Positives = 73/84 (86%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF+RKDWYDVKAP+MF  RQ+G TLVNRTQG +IAS+ LKGRVFEVSLAD
Sbjct: 14  KKGGKKKVVDPFSRKDWYDVKAPNMFQTRQIGKTLVNRTQGQRIASDYLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQ D D ERSFRKFRLIAE VQ R
Sbjct: 74  LQKDIDPERSFRKFRLIAEDVQDR 97



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+++VNKL      +   E      YPL DV+  KVKVLK+  F ++SKL+
Sbjct: 184 LKQLVNKLALDSIAKDI-EKSCQRIYPLHDVYIRKVKVLKKPRF-DVSKLL 232


>AE014135-5|AAN06541.1|  218|Drosophila melanogaster CG2168-PB,
           isoform B protein.
          Length = 218

 Score =  147 bits (356), Expect = 1e-35
 Identities = 71/104 (68%), Positives = 81/104 (77%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VLCNFHGMDLTTDK R MVKKWQTLIEA ++ KT DGY+LRVFCIGFT KD  SQRKTCY
Sbjct: 49  VLCNFHGMDLTTDKYRSMVKKWQTLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCY 108

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           AQ +QVR IR +M +IIT +V+ +D  +       DSIAKDIEK
Sbjct: 109 AQQSQVRKIRARMTDIITNEVSGADLKQLVNKLALDSIAKDIEK 152



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 29/34 (85%), Positives = 29/34 (85%)
 Frame = +2

Query: 152 GRVFEVSLADLQADTDAERSFRKFRLIAEYVQGR 253
           GRVFEVSLADLQ D D ERSFRKFRLIAE VQ R
Sbjct: 14  GRVFEVSLADLQKDIDPERSFRKFRLIAEDVQDR 47



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+++VNKL      +   E      YPL DV+  KVKVLK+  F ++SKL+
Sbjct: 134 LKQLVNKLALDSIAKDI-EKSCQRIYPLHDVYIRKVKVLKKPRF-DVSKLL 182


>AE014135-4|AAF59372.1|  268|Drosophila melanogaster CG2168-PA,
           isoform A protein.
          Length = 268

 Score =  147 bits (356), Expect = 1e-35
 Identities = 71/104 (68%), Positives = 81/104 (77%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VLCNFHGMDLTTDK R MVKKWQTLIEA ++ KT DGY+LRVFCIGFT KD  SQRKTCY
Sbjct: 99  VLCNFHGMDLTTDKYRSMVKKWQTLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCY 158

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           AQ +QVR IR +M +IIT +V+ +D  +       DSIAKDIEK
Sbjct: 159 AQQSQVRKIRARMTDIITNEVSGADLKQLVNKLALDSIAKDIEK 202



 Score =  140 bits (339), Expect = 2e-33
 Identities = 67/84 (79%), Positives = 73/84 (86%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF+RKDWYDVKAP+MF  RQ+G TLVNRTQG +IAS+ LKGRVFEVSLAD
Sbjct: 14  KKGGKKKVVDPFSRKDWYDVKAPNMFQTRQIGKTLVNRTQGQRIASDYLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQ D D ERSFRKFRLIAE VQ R
Sbjct: 74  LQKDIDPERSFRKFRLIAEDVQDR 97



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+++VNKL      +   E      YPL DV+  KVKVLK+  F ++SKL+
Sbjct: 184 LKQLVNKLALDSIAKDI-EKSCQRIYPLHDVYIRKVKVLKKPRF-DVSKLL 232


>Y10115-1|CAA71201.1|  270|Drosophila melanogaster ribosomal protein
           S3a protein.
          Length = 270

 Score =  141 bits (341), Expect = 9e-34
 Identities = 70/105 (66%), Positives = 80/105 (76%), Gaps = 1/105 (0%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VLCNFHGMDLTTDK R MVKKWQTLIEA ++ KT DGY+LRVFCIGFT KD  SQRKTCY
Sbjct: 100 VLCNFHGMDLTTDKYRSMVKKWQTLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCY 159

Query: 436 AQHTQVRAIRK-KMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           A  +QVR IR  +M +IIT +V+ +D  +       DSIAKDIEK
Sbjct: 160 AHESQVRKIRSGRMTDIITNEVSGADLKQLVNKLALDSIAKDIEK 204



 Score =  130 bits (315), Expect = 1e-30
 Identities = 64/85 (75%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLA- 178
           KKG KKK+VDPF+RKDWYDVKAP+MF  RQ+G TLVNRTQG +IAS+  KGRVFEVSL  
Sbjct: 14  KKGGKKKVVDPFSRKDWYDVKAPNMFQTRQIGKTLVNRTQGQRIASDYFKGRVFEVSLVP 73

Query: 179 DLQADTDAERSFRKFRLIAEYVQGR 253
           DLQ D D E SFRKFRLIAE VQ R
Sbjct: 74  DLQKDIDPEHSFRKFRLIAEDVQDR 98



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+++VNKL      +   E      YPL DV+  KVKVLK+  F ++SKL+
Sbjct: 186 LKQLVNKLALDSIAKDI-EKSCQRIYPLHDVYIRKVKVLKKPRF-DVSKLL 234


>AY070949-1|AAL48571.1|  217|Drosophila melanogaster RE04220p
           protein.
          Length = 217

 Score =  140 bits (339), Expect = 2e-33
 Identities = 67/84 (79%), Positives = 73/84 (86%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF+RKDWYDVKAP+MF  RQ+G TLVNRTQG +IAS+ LKGRVFEVSLAD
Sbjct: 14  KKGGKKKVVDPFSRKDWYDVKAPNMFQTRQIGKTLVNRTQGQRIASDYLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQ D D ERSFRKFRLIAE VQ R
Sbjct: 74  LQKDIDPERSFRKFRLIAEDVQDR 97



 Score =  137 bits (331), Expect = 2e-32
 Identities = 62/85 (72%), Positives = 71/85 (83%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VLCNFHGMDLTTDK R MVKKWQTLIEA ++ KT DGY+LRVFCIGFT KD  SQRKTCY
Sbjct: 99  VLCNFHGMDLTTDKYRSMVKKWQTLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCY 158

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSD 510
           AQ +QVR IR +M +IIT +V+ +D
Sbjct: 159 AQQSQVRKIRARMTDIITNEVSGAD 183


>AE014135-6|AAN06542.1|  163|Drosophila melanogaster CG2168-PD,
           isoform D protein.
          Length = 163

 Score =  130 bits (313), Expect = 2e-30
 Identities = 64/97 (65%), Positives = 74/97 (76%)
 Frame = +1

Query: 277 MDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVR 456
           MDLTTDK R MVKKWQTLIEA ++ KT DGY+LRVFCIGFT KD  SQRKTCYAQ +QVR
Sbjct: 1   MDLTTDKYRSMVKKWQTLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCYAQQSQVR 60

Query: 457 AIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
            IR +M +IIT +V+ +D  +       DSIAKDIEK
Sbjct: 61  KIRARMTDIITNEVSGADLKQLVNKLALDSIAKDIEK 97



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+++VNKL      +   E      YPL DV+  KVKVLK+  F ++SKL+
Sbjct: 79  LKQLVNKLALDSIAKDI-EKSCQRIYPLHDVYIRKVKVLKKPRF-DVSKLL 127


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,312,496
Number of Sequences: 53049
Number of extensions: 740667
Number of successful extensions: 2651
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 2445
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2645
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3067209849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).