SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY061158-1|AAL28706.1|  180|Drosophila melanogaster LD12613p pro...    91   1e-18
AE014296-371|AAF47580.1|  180|Drosophila melanogaster CG1919-PA ...    91   1e-18
BT024400-1|ABC86462.1|  162|Drosophila melanogaster IP05056p pro...    91   1e-18
AE014296-1423|AAF50442.1|  162|Drosophila melanogaster CG7076-PA...    91   1e-18
BT010217-1|AAQ23535.1|  194|Drosophila melanogaster RH05746p pro...    89   4e-18
AE014296-370|AAF47579.2|  194|Drosophila melanogaster CG13935-PA...    89   4e-18
AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA...    87   2e-17
BT016066-1|AAV36951.1|  138|Drosophila melanogaster LP12967p pro...    86   3e-17
AE014296-1422|AAF50443.2|  407|Drosophila melanogaster CG7072-PA...    86   3e-17
M71249-1|AAA28501.1|  188|Drosophila melanogaster cuticle protei...    83   2e-16
AE014297-496|AAF54097.2|  188|Drosophila melanogaster CG2345-PA ...    83   2e-16
AE001572-20|AAD19810.1|  188|Drosophila melanogaster pupal-cutic...    83   2e-16
AE014296-3163|AAF49152.1|  198|Drosophila melanogaster CG9290-PA...    82   4e-16
BT023126-1|AAY55542.1|  245|Drosophila melanogaster IP08764p pro...    80   2e-15
BT023042-1|AAY55458.1|  245|Drosophila melanogaster IP08564p pro...    80   2e-15
AE014297-2676|AAF55678.2|  245|Drosophila melanogaster CG6240-PA...    80   2e-15
AY070633-1|AAL48104.1|  192|Drosophila melanogaster RH01578p pro...    79   3e-15
AE014296-792|AAF47861.1|  192|Drosophila melanogaster CG15006-PA...    79   3e-15
BT022916-1|AAY55332.1|  136|Drosophila melanogaster IP04416p pro...    78   1e-14
AE014296-793|AAF47862.1|  147|Drosophila melanogaster CG15007-PA...    78   1e-14
AM294620-1|CAL26618.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294619-1|CAL26617.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294618-1|CAL26616.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294617-1|CAL26615.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294616-1|CAL26614.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294614-1|CAL26612.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294613-1|CAL26611.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294612-1|CAL26610.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294611-1|CAL26609.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294610-1|CAL26608.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AM294609-1|CAL26607.1|  204|Drosophila melanogaster CG9283 protein.    77   1e-14
AE014296-3162|AAF49153.1|  204|Drosophila melanogaster CG9283-PA...    77   1e-14
Y18453-1|CAA77177.1|  472|Drosophila melanogaster drosocrystalli...    77   2e-14
AY119178-1|AAM51038.1|  477|Drosophila melanogaster RH66281p pro...    77   2e-14
AE014134-2114|AAF53134.2|  477|Drosophila melanogaster CG16963-P...    77   2e-14
AY121656-1|AAM51983.1|  206|Drosophila melanogaster RE04513p pro...    77   2e-14
AE014297-497|AAF54096.1|  191|Drosophila melanogaster CG2342-PA ...    77   2e-14
AE001572-19|AAD19809.1|  191|Drosophila melanogaster cuticle pro...    77   2e-14
BT022412-1|AAY54828.1|  424|Drosophila melanogaster IP11572p pro...    76   3e-14
BT022352-1|AAY54768.1|  424|Drosophila melanogaster IP11272p pro...    76   3e-14
BT022288-1|AAY54704.1|  424|Drosophila melanogaster IP11372p pro...    76   3e-14
BT022236-1|AAY54652.1|  424|Drosophila melanogaster IP11472p pro...    76   3e-14
AY070590-1|AAL48061.1|  247|Drosophila melanogaster RE69226p pro...    76   3e-14
AE014296-795|AAF47864.2|  247|Drosophila melanogaster CG1259-PB ...    76   3e-14
AM294615-1|CAL26613.1|  204|Drosophila melanogaster CG9283 protein.    76   4e-14
BT011017-1|AAR30177.1|  205|Drosophila melanogaster RH14104p pro...    75   7e-14
AE014297-503|AAF54090.1|  205|Drosophila melanogaster CG2360-PA ...    75   7e-14
AE014296-3164|AAF49151.1|  401|Drosophila melanogaster CG9295-PB...    75   7e-14
AE001572-13|AAD19803.1|  205|Drosophila melanogaster cuticle pro...    75   7e-14
AE014297-502|AAF54091.1|  221|Drosophila melanogaster CG1252-PA ...    74   2e-13
AE001572-14|AAD19804.1|  221|Drosophila melanogaster cuticle pro...    74   2e-13
AE014297-501|AAF54092.1|  217|Drosophila melanogaster CG1327-PA ...    73   3e-13
AE014297-500|AAF54093.1|  199|Drosophila melanogaster CG2341-PA ...    73   3e-13
AE001572-16|AAD19806.1|  199|Drosophila melanogaster cuticle pro...    73   3e-13
AE001572-15|AAD19805.1|  217|Drosophila melanogaster cuticle pro...    73   3e-13
AE014297-498|AAF54095.1|  151|Drosophila melanogaster CG1331-PA ...    72   5e-13
AE001572-18|AAD19808.1|  151|Drosophila melanogaster cuticle pro...    72   5e-13
AE014298-801|AAF46087.1|  145|Drosophila melanogaster CG4052-PA ...    72   6e-13
AY070676-1|AAL48147.1|  221|Drosophila melanogaster RH13984p pro...    71   1e-12
AE014134-2498|AAF53397.1|  218|Drosophila melanogaster CG3474-PA...    70   2e-12
BT022677-1|AAY55093.1|  202|Drosophila melanogaster IP07124p pro...    68   8e-12
AE014296-794|AAF47863.1|  188|Drosophila melanogaster CG15008-PA...    68   8e-12
BT024343-1|ABC86405.1|  266|Drosophila melanogaster IP09562p pro...    66   2e-11
AE014296-1421|AAF50444.1|  266|Drosophila melanogaster CG13670-P...    66   2e-11
AY070951-1|AAL48573.1|  208|Drosophila melanogaster RE04882p pro...    66   3e-11
AE014297-499|AAF54094.1|  208|Drosophila melanogaster CG1330-PA ...    66   3e-11
AE001572-17|AAD19807.1|  208|Drosophila melanogaster cuticle pro...    66   3e-11
AE014134-1731|AAN10713.1|  146|Drosophila melanogaster CG31876-P...    63   2e-10
AY071302-1|AAL48924.1|  302|Drosophila melanogaster RE33041p pro...    61   9e-10
AE014134-1650|AAF52783.2|  153|Drosophila melanogaster CG3818-PA...    61   9e-10
AE014134-486|AAF51198.2|  302|Drosophila melanogaster CG2973-PA ...    61   9e-10
BT011451-1|AAR99109.1|  340|Drosophila melanogaster RE37955p pro...    60   2e-09
AE014134-1758|AAN10718.1|  340|Drosophila melanogaster CG33302-P...    60   2e-09
AE014134-1730|AAN10712.1|  146|Drosophila melanogaster CG31878-P...    56   4e-08
AE014134-1729|AAN10711.1|  106|Drosophila melanogaster CG31878-P...    56   4e-08
AY071527-1|AAL49149.1|  270|Drosophila melanogaster RE57183p pro...    53   3e-07
AE014296-1500|AAF50383.2|  270|Drosophila melanogaster CG32029-P...    53   3e-07
AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-P...    49   5e-06
AY060758-1|AAL28306.1|  178|Drosophila melanogaster GH20904p pro...    46   3e-05
AE013599-1764|AAF58336.1|  178|Drosophila melanogaster CG6305-PA...    46   3e-05
AY071231-1|AAL48853.1|  217|Drosophila melanogaster RE26879p pro...    45   8e-05
AE013599-2993|AAF57484.2|  217|Drosophila melanogaster CG9036-PA...    45   8e-05
AE014296-2716|AAF49477.1|  217|Drosophila melanogaster CG12255-P...    38   0.013
AY069040-1|AAL39185.1|  429|Drosophila melanogaster GH03623p pro...    36   0.029
AE014296-2717|AAF49476.1|  429|Drosophila melanogaster CG4784-PA...    36   0.029
AY071448-1|AAL49070.1|  815|Drosophila melanogaster RE53044p pro...    36   0.038
AE013599-1762|AAF58339.2|  815|Drosophila melanogaster CG13338-P...    36   0.038
AE013599-1477|AAF58517.1|  126|Drosophila melanogaster CG8510-PA...    36   0.038
AY070997-1|AAL48619.1|  144|Drosophila melanogaster RE08808p pro...    35   0.067
AE013599-1904|AAF58238.1|  144|Drosophila melanogaster CG10112-P...    35   0.067
AF106677-1|AAD05225.1|  693|Drosophila melanogaster dissatisfact...    32   0.47 
AE014134-989|AAF52303.1|  691|Drosophila melanogaster CG9019-PA ...    32   0.47 
AE014297-4062|AAF56660.2|  366|Drosophila melanogaster CG6131-PA...    31   0.82 

>AY061158-1|AAL28706.1|  180|Drosophila melanogaster LD12613p
           protein.
          Length = 180

 Score = 91.1 bits (216), Expect = 1e-18
 Identities = 40/68 (58%), Positives = 48/68 (70%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           HG   +  DY A+PKY + Y + D HTGD+KSQHE RDGDVVKG YSL E DGS+R VEY
Sbjct: 39  HGHHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEY 98

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 99  TADDHNGF 106


>AE014296-371|AAF47580.1|  180|Drosophila melanogaster CG1919-PA
           protein.
          Length = 180

 Score = 91.1 bits (216), Expect = 1e-18
 Identities = 40/68 (58%), Positives = 48/68 (70%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           HG   +  DY A+PKY + Y + D HTGD+KSQHE RDGDVVKG YSL E DGS+R VEY
Sbjct: 39  HGHHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEY 98

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 99  TADDHNGF 106


>BT024400-1|ABC86462.1|  162|Drosophila melanogaster IP05056p
           protein.
          Length = 162

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 42/68 (61%), Positives = 51/68 (75%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           HG   ++ DY A PKYAF+Y + D HTGD+KSQHETRDGD VKG YSL E DGSIR V+Y
Sbjct: 75  HGHD-EHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDY 133

Query: 449 SAEQAQWF 472
           +A++   F
Sbjct: 134 TADKHNGF 141


>AE014296-1423|AAF50442.1|  162|Drosophila melanogaster CG7076-PA
           protein.
          Length = 162

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 42/68 (61%), Positives = 51/68 (75%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           HG   ++ DY A PKYAF+Y + D HTGD+KSQHETRDGD VKG YSL E DGSIR V+Y
Sbjct: 75  HGHD-EHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDY 133

Query: 449 SAEQAQWF 472
           +A++   F
Sbjct: 134 TADKHNGF 141


>BT010217-1|AAQ23535.1|  194|Drosophila melanogaster RH05746p
           protein.
          Length = 194

 Score = 89.0 bits (211), Expect = 4e-18
 Identities = 42/66 (63%), Positives = 48/66 (72%), Gaps = 1/66 (1%)
 Frame = +2

Query: 278 QPQYE-DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           +P Y  DY  HPKYAF Y + D  TGD+KSQHETRDGDVVKG YSL E DGSIR V+Y+A
Sbjct: 22  RPGYALDYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTA 81

Query: 455 EQAQWF 472
           +    F
Sbjct: 82  DSIHGF 87


>AE014296-370|AAF47579.2|  194|Drosophila melanogaster CG13935-PA
           protein.
          Length = 194

 Score = 89.0 bits (211), Expect = 4e-18
 Identities = 42/66 (63%), Positives = 48/66 (72%), Gaps = 1/66 (1%)
 Frame = +2

Query: 278 QPQYE-DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           +P Y  DY  HPKYAF Y + D  TGD+KSQHETRDGDVVKG YSL E DGSIR V+Y+A
Sbjct: 22  RPGYALDYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTA 81

Query: 455 EQAQWF 472
           +    F
Sbjct: 82  DSIHGF 87


>AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA
            protein.
          Length = 1242

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 37/56 (66%), Positives = 44/56 (78%)
 Frame = +2

Query: 290  EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
            E +DAHP+YAFEY + DPHTGD K Q E RDGDVVKG YSL E DG++R V+Y A+
Sbjct: 1159 EHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYAD 1214


>BT016066-1|AAV36951.1|  138|Drosophila melanogaster LP12967p
           protein.
          Length = 138

 Score = 86.2 bits (204), Expect = 3e-17
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query: 254 NAPV-HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGS 430
           +APV  H     + +  A+PKY+F Y I+DPHTGD+KSQ E RDGDVVKG YSL E DGS
Sbjct: 31  HAPVLSHAVHAVHAEPVAYPKYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGS 90

Query: 431 IRVVEYSAEQAQWF 472
           +R V+Y+A+    F
Sbjct: 91  VRTVDYTADDHNGF 104


>AE014296-1422|AAF50443.2|  407|Drosophila melanogaster CG7072-PA
           protein.
          Length = 407

 Score = 86.2 bits (204), Expect = 3e-17
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query: 254 NAPV-HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGS 430
           +APV  H     + +  A+PKY+F Y I+DPHTGD+KSQ E RDGDVVKG YSL E DGS
Sbjct: 70  HAPVLSHAVHAVHAEPVAYPKYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGS 129

Query: 431 IRVVEYSAEQAQWF 472
           +R V+Y+A+    F
Sbjct: 130 VRTVDYTADDHNGF 143



 Score = 34.3 bits (75), Expect = 0.12
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETR-DGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           Y+F Y+I DP T + + + E R     ++G Y     DG I V +Y A++
Sbjct: 157 YSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKE 206


>M71249-1|AAA28501.1|  188|Drosophila melanogaster cuticle protein
           protein.
          Length = 188

 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 33/61 (54%), Positives = 48/61 (78%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           + YD+HP+Y+F Y ++DP TGD+KSQ E+RDGDVV G YS+++ADG  R V+Y+A+  + 
Sbjct: 29  DTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRG 88

Query: 470 F 472
           F
Sbjct: 89  F 89


>AE014297-496|AAF54097.2|  188|Drosophila melanogaster CG2345-PA
           protein.
          Length = 188

 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 33/61 (54%), Positives = 48/61 (78%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           + YD+HP+Y+F Y ++DP TGD+KSQ E+RDGDVV G YS+++ADG  R V+Y+A+  + 
Sbjct: 29  DTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRG 88

Query: 470 F 472
           F
Sbjct: 89  F 89


>AE001572-20|AAD19810.1|  188|Drosophila melanogaster
           pupal-cuticle-protein protein.
          Length = 188

 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 33/61 (54%), Positives = 48/61 (78%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           + YD+HP+Y+F Y ++DP TGD+KSQ E+RDGDVV G YS+++ADG  R V+Y+A+  + 
Sbjct: 29  DTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRG 88

Query: 470 F 472
           F
Sbjct: 89  F 89


>AE014296-3163|AAF49152.1|  198|Drosophila melanogaster CG9290-PA
           protein.
          Length = 198

 Score = 82.2 bits (194), Expect = 4e-16
 Identities = 39/71 (54%), Positives = 49/71 (69%), Gaps = 2/71 (2%)
 Frame = +2

Query: 266 HHGDQPQYEDYDAH--PKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRV 439
           H G    Y+ ++ H  PKY F+Y ++D HTGD KSQ ETRDGD VKG YSL E+DG+ RV
Sbjct: 68  HSGYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRV 127

Query: 440 VEYSAEQAQWF 472
           VEY+A+    F
Sbjct: 128 VEYTADDHNGF 138


>BT023126-1|AAY55542.1|  245|Drosophila melanogaster IP08764p
           protein.
          Length = 245

 Score = 80.2 bits (189), Expect = 2e-15
 Identities = 36/61 (59%), Positives = 45/61 (73%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E YD  PKY+F Y I+D +TGDLKSQHETR GDVVKG YS+ + DG+ R V+Y+A+    
Sbjct: 60  EPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHG 119

Query: 470 F 472
           F
Sbjct: 120 F 120


>BT023042-1|AAY55458.1|  245|Drosophila melanogaster IP08564p
           protein.
          Length = 245

 Score = 80.2 bits (189), Expect = 2e-15
 Identities = 36/61 (59%), Positives = 45/61 (73%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E YD  PKY+F Y I+D +TGDLKSQHETR GDVVKG YS+ + DG+ R V+Y+A+    
Sbjct: 60  EPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHG 119

Query: 470 F 472
           F
Sbjct: 120 F 120


>AE014297-2676|AAF55678.2|  245|Drosophila melanogaster CG6240-PA
           protein.
          Length = 245

 Score = 80.2 bits (189), Expect = 2e-15
 Identities = 36/61 (59%), Positives = 45/61 (73%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E YD  PKY+F Y I+D +TGDLKSQHETR GDVVKG YS+ + DG+ R V+Y+A+    
Sbjct: 60  EPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHG 119

Query: 470 F 472
           F
Sbjct: 120 F 120


>AY070633-1|AAL48104.1|  192|Drosophila melanogaster RH01578p
           protein.
          Length = 192

 Score = 79.4 bits (187), Expect = 3e-15
 Identities = 35/61 (57%), Positives = 44/61 (72%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E YD +P+Y F Y + D  TGD+KSQ ETR GDVV+G YSL EADG+ R+VEY+A+    
Sbjct: 52  EPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHG 111

Query: 470 F 472
           F
Sbjct: 112 F 112


>AE014296-792|AAF47861.1|  192|Drosophila melanogaster CG15006-PA
           protein.
          Length = 192

 Score = 79.4 bits (187), Expect = 3e-15
 Identities = 35/61 (57%), Positives = 44/61 (72%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E YD +P+Y F Y + D  TGD+KSQ ETR GDVV+G YSL EADG+ R+VEY+A+    
Sbjct: 52  EPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHG 111

Query: 470 F 472
           F
Sbjct: 112 F 112


>BT022916-1|AAY55332.1|  136|Drosophila melanogaster IP04416p
           protein.
          Length = 136

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 35/64 (54%), Positives = 44/64 (68%)
 Frame = +2

Query: 281 PQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           P   + D HP+YAF Y ++D  TGD KSQ E RDGDVVKG YS+ +ADGS+R V Y+A+ 
Sbjct: 47  PLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADP 106

Query: 461 AQWF 472
              F
Sbjct: 107 INGF 110


>AE014296-793|AAF47862.1|  147|Drosophila melanogaster CG15007-PA
           protein.
          Length = 147

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 35/64 (54%), Positives = 44/64 (68%)
 Frame = +2

Query: 281 PQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           P   + D HP+YAF Y ++D  TGD KSQ E RDGDVVKG YS+ +ADGS+R V Y+A+ 
Sbjct: 58  PLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADP 117

Query: 461 AQWF 472
              F
Sbjct: 118 INGF 121


>AM294620-1|CAL26618.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294619-1|CAL26617.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294618-1|CAL26616.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294617-1|CAL26615.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294616-1|CAL26614.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294614-1|CAL26612.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294613-1|CAL26611.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294612-1|CAL26610.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294611-1|CAL26609.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294610-1|CAL26608.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HRQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AM294609-1|CAL26607.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>AE014296-3162|AAF49153.1|  204|Drosophila melanogaster CG9283-PA
           protein.
          Length = 204

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 34/68 (50%), Positives = 44/68 (64%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SAEQAQWF 472
           +A+    F
Sbjct: 145 TADSHNGF 152


>Y18453-1|CAA77177.1|  472|Drosophila melanogaster drosocrystallin
           protein.
          Length = 472

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 34/61 (55%), Positives = 42/61 (68%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           EDYD  P+Y+F Y + D  TGD K Q E RDGD+VKG YSL E DG+ R+VEY+A+    
Sbjct: 69  EDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSG 128

Query: 470 F 472
           F
Sbjct: 129 F 129


>AY119178-1|AAM51038.1|  477|Drosophila melanogaster RH66281p
           protein.
          Length = 477

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 34/61 (55%), Positives = 42/61 (68%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           EDYD  P+Y+F Y + D  TGD K Q E RDGD+VKG YSL E DG+ R+VEY+A+    
Sbjct: 69  EDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSG 128

Query: 470 F 472
           F
Sbjct: 129 F 129


>AE014134-2114|AAF53134.2|  477|Drosophila melanogaster CG16963-PA
           protein.
          Length = 477

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 34/61 (55%), Positives = 42/61 (68%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           EDYD  P+Y+F Y + D  TGD K Q E RDGD+VKG YSL E DG+ R+VEY+A+    
Sbjct: 69  EDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSG 128

Query: 470 F 472
           F
Sbjct: 129 F 129


>AY121656-1|AAM51983.1|  206|Drosophila melanogaster RE04513p
           protein.
          Length = 206

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 32/63 (50%), Positives = 47/63 (74%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           Q E+YD HP+Y + Y ++D  +GD K+Q ETR+GDVV+G YSL++ADG  R+V+Y+A+  
Sbjct: 47  QVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPI 106

Query: 464 QWF 472
             F
Sbjct: 107 NGF 109


>AE014297-497|AAF54096.1|  191|Drosophila melanogaster CG2342-PA
           protein.
          Length = 191

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 32/63 (50%), Positives = 47/63 (74%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           Q E+YD HP+Y + Y ++D  +GD K+Q ETR+GDVV+G YSL++ADG  R+V+Y+A+  
Sbjct: 32  QVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPI 91

Query: 464 QWF 472
             F
Sbjct: 92  NGF 94


>AE001572-19|AAD19809.1|  191|Drosophila melanogaster cuticle
           protein protein.
          Length = 191

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 32/63 (50%), Positives = 47/63 (74%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           Q E+YD HP+Y + Y ++D  +GD K+Q ETR+GDVV+G YSL++ADG  R+V+Y+A+  
Sbjct: 32  QVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPI 91

Query: 464 QWF 472
             F
Sbjct: 92  NGF 94


>BT022412-1|AAY54828.1|  424|Drosophila melanogaster IP11572p
           protein.
          Length = 424

 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 34/63 (53%), Positives = 45/63 (71%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           +Y  +  H  YAF Y ++D HTGD+KSQ E+RDGD VKG+YS+ E DGSIR V Y+A+  
Sbjct: 46  EYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAK 105

Query: 464 QWF 472
           + F
Sbjct: 106 KGF 108


>BT022352-1|AAY54768.1|  424|Drosophila melanogaster IP11272p
           protein.
          Length = 424

 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 34/63 (53%), Positives = 45/63 (71%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           +Y  +  H  YAF Y ++D HTGD+KSQ E+RDGD VKG+YS+ E DGSIR V Y+A+  
Sbjct: 46  EYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAK 105

Query: 464 QWF 472
           + F
Sbjct: 106 KGF 108


>BT022288-1|AAY54704.1|  424|Drosophila melanogaster IP11372p
           protein.
          Length = 424

 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 34/63 (53%), Positives = 45/63 (71%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           +Y  +  H  YAF Y ++D HTGD+KSQ E+RDGD VKG+YS+ E DGSIR V Y+A+  
Sbjct: 46  EYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAK 105

Query: 464 QWF 472
           + F
Sbjct: 106 KGF 108


>BT022236-1|AAY54652.1|  424|Drosophila melanogaster IP11472p
           protein.
          Length = 424

 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 34/63 (53%), Positives = 45/63 (71%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           +Y  +  H  YAF Y ++D HTGD+KSQ E+RDGD VKG+YS+ E DGSIR V Y+A+  
Sbjct: 46  EYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAK 105

Query: 464 QWF 472
           + F
Sbjct: 106 KGF 108


>AY070590-1|AAL48061.1|  247|Drosophila melanogaster RE69226p
           protein.
          Length = 247

 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 35/61 (57%), Positives = 42/61 (68%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E  DAHP+Y F Y ++D  TGD K+Q ETRDGDVV+G YSL E DGS R+V Y A+    
Sbjct: 138 EIVDAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSING 197

Query: 470 F 472
           F
Sbjct: 198 F 198


>AE014296-795|AAF47864.2|  247|Drosophila melanogaster CG1259-PB
           protein.
          Length = 247

 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 35/61 (57%), Positives = 42/61 (68%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E  DAHP+Y F Y ++D  TGD K+Q ETRDGDVV+G YSL E DGS R+V Y A+    
Sbjct: 138 EIVDAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSING 197

Query: 470 F 472
           F
Sbjct: 198 F 198


>AM294615-1|CAL26613.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 33/62 (53%), Positives = 42/62 (67%)
 Frame = +2

Query: 269 HGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEY 448
           H     +E+   HPKY F Y ++D  TGD+K Q ETRDGD VKG Y++ EADG  R+VEY
Sbjct: 85  HHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEY 144

Query: 449 SA 454
           +A
Sbjct: 145 TA 146


>BT011017-1|AAR30177.1|  205|Drosophila melanogaster RH14104p
           protein.
          Length = 205

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 33/61 (54%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y F Y ++D  TGD K Q E RDGDVV+G YSL +ADG  R+V+Y+A+    
Sbjct: 54  EEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPING 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE014297-503|AAF54090.1|  205|Drosophila melanogaster CG2360-PA
           protein.
          Length = 205

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 33/61 (54%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y F Y ++D  TGD K Q E RDGDVV+G YSL +ADG  R+V+Y+A+    
Sbjct: 54  EEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPING 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE014296-3164|AAF49151.1|  401|Drosophila melanogaster CG9295-PB
           protein.
          Length = 401

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 33/59 (55%), Positives = 43/59 (72%)
 Frame = +2

Query: 296 YDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           +  H  YAF Y ++D HTGD+KSQ E+RDGD VKG+YS+ E DGSIR V Y+A+  + F
Sbjct: 27  FQEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGF 85


>AE001572-13|AAD19803.1|  205|Drosophila melanogaster cuticle
           protein protein.
          Length = 205

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 33/61 (54%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y F Y ++D  TGD K Q E RDGDVV+G YSL +ADG  R+V+Y+A+    
Sbjct: 54  EEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPING 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE014297-502|AAF54091.1|  221|Drosophila melanogaster CG1252-PA
           protein.
          Length = 221

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 33/61 (54%), Positives = 42/61 (68%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y F Y ++D  TGD K Q E RDGDVV+G YSL +ADG  R V+Y+A+    
Sbjct: 54  EEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPING 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE001572-14|AAD19804.1|  221|Drosophila melanogaster cuticle
           protein protein.
          Length = 221

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 33/61 (54%), Positives = 42/61 (68%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y F Y ++D  TGD K Q E RDGDVV+G YSL +ADG  R V+Y+A+    
Sbjct: 54  EEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPING 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE014297-501|AAF54092.1|  217|Drosophila melanogaster CG1327-PA
           protein.
          Length = 217

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 35/70 (50%), Positives = 45/70 (64%)
 Frame = +2

Query: 263 VHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           +H      Y D D HPKY F Y ++D  +GD KSQ E+RDGDVV+G YSL +ADG  R V
Sbjct: 49  IHPHGHEVYPD-DPHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTV 107

Query: 443 EYSAEQAQWF 472
           +Y+A+    F
Sbjct: 108 KYTADSVNGF 117


>AE014297-500|AAF54093.1|  199|Drosophila melanogaster CG2341-PA
           protein.
          Length = 199

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/61 (52%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y + Y ++D  +GD KSQ E RDGDVV+G YSL +ADG  R V+Y+A+    
Sbjct: 54  EEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPING 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE001572-16|AAD19806.1|  199|Drosophila melanogaster cuticle
           protein protein.
          Length = 199

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 32/61 (52%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y + Y ++D  +GD KSQ E RDGDVV+G YSL +ADG  R V+Y+A+    
Sbjct: 54  EEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPING 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE001572-15|AAD19805.1|  217|Drosophila melanogaster cuticle
           protein protein.
          Length = 217

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 35/70 (50%), Positives = 45/70 (64%)
 Frame = +2

Query: 263 VHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           +H      Y D D HPKY F Y ++D  +GD KSQ E+RDGDVV+G YSL +ADG  R V
Sbjct: 49  IHPHGHEVYPD-DPHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTV 107

Query: 443 EYSAEQAQWF 472
           +Y+A+    F
Sbjct: 108 KYTADSVNGF 117


>AE014297-498|AAF54095.1|  151|Drosophila melanogaster CG1331-PA
           protein.
          Length = 151

 Score = 72.1 bits (169), Expect = 5e-13
 Identities = 31/61 (50%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y F Y ++D  +GD KSQ E RDGDVV G YSL ++DG  R+V+Y+++    
Sbjct: 54  EEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNG 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE001572-18|AAD19808.1|  151|Drosophila melanogaster cuticle
           protein protein.
          Length = 151

 Score = 72.1 bits (169), Expect = 5e-13
 Identities = 31/61 (50%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y F Y ++D  +GD KSQ E RDGDVV G YSL ++DG  R+V+Y+++    
Sbjct: 54  EEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNG 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE014298-801|AAF46087.1|  145|Drosophila melanogaster CG4052-PA
           protein.
          Length = 145

 Score = 71.7 bits (168), Expect = 6e-13
 Identities = 31/61 (50%), Positives = 43/61 (70%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y + Y ++D  +GD KSQ E RDGDVV+G YSL ++DG  R V+Y+A+    
Sbjct: 56  EEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPING 115

Query: 470 F 472
           F
Sbjct: 116 F 116


>AY070676-1|AAL48147.1|  221|Drosophila melanogaster RH13984p
           protein.
          Length = 221

 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 32/61 (52%), Positives = 41/61 (67%)
 Frame = +2

Query: 290 EDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQW 469
           E+YD HP+Y F Y ++D  TGD K Q E R GDVV+G YSL +ADG  R V+Y+A+    
Sbjct: 54  EEYDPHPQYRFSYGVDDKLTGDNKGQVEERGGDVVRGEYSLIDADGYKRTVQYTADPING 113

Query: 470 F 472
           F
Sbjct: 114 F 114


>AE014134-2498|AAF53397.1|  218|Drosophila melanogaster CG3474-PA
           protein.
          Length = 218

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query: 266 HHGDQPQYEDY-DAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVV 442
           HH D   ++D+ D+H +Y F+Y ++D  TGD+KSQ E+R G  V G+Y L +ADG  R V
Sbjct: 55  HHHDHHGHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTV 114

Query: 443 EYSAEQAQWF 472
            Y+A++ + F
Sbjct: 115 HYTADKHKGF 124


>BT022677-1|AAY55093.1|  202|Drosophila melanogaster IP07124p
           protein.
          Length = 202

 Score = 68.1 bits (159), Expect = 8e-12
 Identities = 34/72 (47%), Positives = 42/72 (58%)
 Frame = +2

Query: 257 APVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           APV        E YD +P+Y+F Y + D HTGD K Q ET    VV G YSL E DG+IR
Sbjct: 87  APVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIR 146

Query: 437 VVEYSAEQAQWF 472
            V Y+A++   F
Sbjct: 147 KVTYTADKVNGF 158


>AE014296-794|AAF47863.1|  188|Drosophila melanogaster CG15008-PA
           protein.
          Length = 188

 Score = 68.1 bits (159), Expect = 8e-12
 Identities = 34/72 (47%), Positives = 42/72 (58%)
 Frame = +2

Query: 257 APVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIR 436
           APV        E YD +P+Y+F Y + D HTGD K Q ET    VV G YSL E DG+IR
Sbjct: 73  APVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIR 132

Query: 437 VVEYSAEQAQWF 472
            V Y+A++   F
Sbjct: 133 KVTYTADKVNGF 144


>BT024343-1|ABC86405.1|  266|Drosophila melanogaster IP09562p
           protein.
          Length = 266

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 29/60 (48%), Positives = 44/60 (73%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           DY A P+Y+F Y +ED  T  L+++ ETR+GD V+G YS+ + DG++RVV+Y+A+ A  F
Sbjct: 96  DYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGF 155


>AE014296-1421|AAF50444.1|  266|Drosophila melanogaster CG13670-PA
           protein.
          Length = 266

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 29/60 (48%), Positives = 44/60 (73%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           DY A P+Y+F Y +ED  T  L+++ ETR+GD V+G YS+ + DG++RVV+Y+A+ A  F
Sbjct: 96  DYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGF 155


>AY070951-1|AAL48573.1|  208|Drosophila melanogaster RE04882p
           protein.
          Length = 208

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 29/63 (46%), Positives = 40/63 (63%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           + E+ D HP+Y + Y ++D  +GD K   E RDGDVV+G YSL +ADG  R V Y+A+  
Sbjct: 41  ELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSI 100

Query: 464 QWF 472
             F
Sbjct: 101 NGF 103


>AE014297-499|AAF54094.1|  208|Drosophila melanogaster CG1330-PA
           protein.
          Length = 208

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 29/63 (46%), Positives = 40/63 (63%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           + E+ D HP+Y + Y ++D  +GD K   E RDGDVV+G YSL +ADG  R V Y+A+  
Sbjct: 41  ELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSI 100

Query: 464 QWF 472
             F
Sbjct: 101 NGF 103


>AE001572-17|AAD19807.1|  208|Drosophila melanogaster cuticle
           protein protein.
          Length = 208

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 29/63 (46%), Positives = 40/63 (63%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           + E+ D HP+Y + Y ++D  +GD K   E RDGDVV+G YSL +ADG  R V Y+A+  
Sbjct: 41  ELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSI 100

Query: 464 QWF 472
             F
Sbjct: 101 NGF 103


>AE014134-1731|AAN10713.1|  146|Drosophila melanogaster CG31876-PA
           protein.
          Length = 146

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 27/60 (45%), Positives = 40/60 (66%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           + +A   Y F Y + D HTGD+KSQ E+R GD V+G Y+L +ADG +R V+Y+++    F
Sbjct: 38  EVEAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGF 97


>AY071302-1|AAL48924.1|  302|Drosophila melanogaster RE33041p
           protein.
          Length = 302

 Score = 61.3 bits (142), Expect = 9e-10
 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 2/65 (3%)
 Frame = +2

Query: 284 QYEDYDAHP--KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           Q+++ +  P   Y+F Y + D  TGD+K   ETRDG VV+G+YSL + DG  R V Y+A+
Sbjct: 145 QHQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTAD 204

Query: 458 QAQWF 472
               F
Sbjct: 205 DVHGF 209


>AE014134-1650|AAF52783.2|  153|Drosophila melanogaster CG3818-PA
           protein.
          Length = 153

 Score = 61.3 bits (142), Expect = 9e-10
 Identities = 25/53 (47%), Positives = 36/53 (67%)
 Frame = +2

Query: 314 YAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           Y F++ + DPHTGD+KSQ E+R  D V+G Y L ++DG  R+V+Y A+    F
Sbjct: 33  YEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGF 85


>AE014134-486|AAF51198.2|  302|Drosophila melanogaster CG2973-PA
           protein.
          Length = 302

 Score = 61.3 bits (142), Expect = 9e-10
 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 2/65 (3%)
 Frame = +2

Query: 284 QYEDYDAHP--KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           Q+++ +  P   Y+F Y + D  TGD+K   ETRDG VV+G+YSL + DG  R V Y+A+
Sbjct: 145 QHQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTAD 204

Query: 458 QAQWF 472
               F
Sbjct: 205 DVHGF 209


>BT011451-1|AAR99109.1|  340|Drosophila melanogaster RE37955p
           protein.
          Length = 340

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/60 (46%), Positives = 38/60 (63%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           + ++ P+Y F Y + D  TGD+KSQ ETRDG  V G YS+ +ADG  R V Y+A+    F
Sbjct: 128 ELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGF 187


>AE014134-1758|AAN10718.1|  340|Drosophila melanogaster CG33302-PA
           protein.
          Length = 340

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/60 (46%), Positives = 38/60 (63%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQAQWF 472
           + ++ P+Y F Y + D  TGD+KSQ ETRDG  V G YS+ +ADG  R V Y+A+    F
Sbjct: 128 ELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGF 187


>AE014134-1730|AAN10712.1|  146|Drosophila melanogaster CG31878-PA,
           isoform A protein.
          Length = 146

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 23/49 (46%), Positives = 33/49 (67%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           +Y F Y + D H+GD+K Q E R G+ V G YSL + DG  R+V+Y+A+
Sbjct: 81  QYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTAD 129


>AE014134-1729|AAN10711.1|  106|Drosophila melanogaster CG31878-PB,
           isoform B protein.
          Length = 106

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 23/49 (46%), Positives = 33/49 (67%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           +Y F Y + D H+GD+K Q E R G+ V G YSL + DG  R+V+Y+A+
Sbjct: 41  QYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTAD 89


>AY071527-1|AAL49149.1|  270|Drosophila melanogaster RE57183p
           protein.
          Length = 270

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 24/66 (36%), Positives = 42/66 (63%), Gaps = 1/66 (1%)
 Frame = +2

Query: 278 QPQYEDYD-AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           Q + E+YD  +  Y F + ++D    + +++ E RDG V+KG YS+ ++DG IR V+Y+A
Sbjct: 145 QNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTA 204

Query: 455 EQAQWF 472
           +  + F
Sbjct: 205 DPKEGF 210


>AE014296-1500|AAF50383.2|  270|Drosophila melanogaster CG32029-PA
           protein.
          Length = 270

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 24/66 (36%), Positives = 42/66 (63%), Gaps = 1/66 (1%)
 Frame = +2

Query: 278 QPQYEDYD-AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSA 454
           Q + E+YD  +  Y F + ++D    + +++ E RDG V+KG YS+ ++DG IR V+Y+A
Sbjct: 145 QNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTA 204

Query: 455 EQAQWF 472
           +  + F
Sbjct: 205 DPKEGF 210


>AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-PA,
           isoform A protein.
          Length = 620

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = +2

Query: 272 GDQPQYEDYDAHP--KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVE 445
           G  P   DYD     KY F Y++ED  +G      E RDGD   G Y++   DG  ++VE
Sbjct: 329 GSGPGGADYDNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVE 388

Query: 446 YSAEQ 460
           Y A+Q
Sbjct: 389 YEADQ 393


>AY060758-1|AAL28306.1|  178|Drosophila melanogaster GH20904p
           protein.
          Length = 178

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 25/71 (35%), Positives = 37/71 (52%)
 Frame = +2

Query: 245 SP*NAPVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEAD 424
           +P N P   GD   +      P Y FEY ++DP T +  +   + DGDVV G Y +   D
Sbjct: 70  TPRNIPGQPGDD--HVHVPGMP-YDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPD 126

Query: 425 GSIRVVEYSAE 457
           G  ++V Y+A+
Sbjct: 127 GRTQIVRYTAD 137


>AE013599-1764|AAF58336.1|  178|Drosophila melanogaster CG6305-PA
           protein.
          Length = 178

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 25/71 (35%), Positives = 37/71 (52%)
 Frame = +2

Query: 245 SP*NAPVHHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEAD 424
           +P N P   GD   +      P Y FEY ++DP T +  +   + DGDVV G Y +   D
Sbjct: 70  TPRNIPGQPGDD--HVHVPGMP-YDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPD 126

Query: 425 GSIRVVEYSAE 457
           G  ++V Y+A+
Sbjct: 127 GRTQIVRYTAD 137


>AY071231-1|AAL48853.1|  217|Drosophila melanogaster RE26879p
           protein.
          Length = 217

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           KY F+Y ++D  +G+     E+RDGD+  G Y +   DG  ++VEY A+Q
Sbjct: 127 KYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ 176


>AE013599-2993|AAF57484.2|  217|Drosophila melanogaster CG9036-PA
           protein.
          Length = 217

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQ 460
           KY F+Y ++D  +G+     E+RDGD+  G Y +   DG  ++VEY A+Q
Sbjct: 127 KYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ 176


>AE014296-2716|AAF49477.1|  217|Drosophila melanogaster CG12255-PA
           protein.
          Length = 217

 Score = 37.5 bits (83), Expect = 0.013
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGD-VVKGYYSLHEADGSIRVVEYSAE 457
           QY   D H +YA+ Y         L S+HETR  D V++G +S  +A+G  + V+Y A+
Sbjct: 35  QYHHQDEHGQYAYGY------MAPLYSKHETRTVDGVIRGTFSHIDANGETQTVDYVAD 87


>AY069040-1|AAL39185.1|  429|Drosophila melanogaster GH03623p
           protein.
          Length = 429

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 287 YEDYD-AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           Y++ D A   Y++ Y+ E+      ++++ +RDG   +G+YS  +ADG ++ V Y A   
Sbjct: 29  YQEQDTARAFYSYGYRDENA----ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGV 83

Query: 464 QWF 472
           Q F
Sbjct: 84  QGF 86


>AE014296-2717|AAF49476.1|  429|Drosophila melanogaster CG4784-PA
           protein.
          Length = 429

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +2

Query: 287 YEDYD-AHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAEQA 463
           Y++ D A   Y++ Y+ E+      ++++ +RDG   +G+YS  +ADG ++ V Y A   
Sbjct: 29  YQEQDTARAFYSYGYRDENA----ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGV 83

Query: 464 QWF 472
           Q F
Sbjct: 84  QGF 86


>AY071448-1|AAL49070.1|  815|Drosophila melanogaster RE53044p
           protein.
          Length = 815

 Score = 35.9 bits (79), Expect = 0.038
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRD-GDVVKGYYSLHEADGSIRVVEYSAE 457
           KY F Y+I D HTG+     + RD   V +G Y +   DG I+ V Y A+
Sbjct: 750 KYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHAD 799


>AE013599-1762|AAF58339.2|  815|Drosophila melanogaster CG13338-PA
           protein.
          Length = 815

 Score = 35.9 bits (79), Expect = 0.038
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 311 KYAFEYKIEDPHTGDLKSQHETRD-GDVVKGYYSLHEADGSIRVVEYSAE 457
           KY F Y+I D HTG+     + RD   V +G Y +   DG I+ V Y A+
Sbjct: 750 KYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHAD 799


>AE013599-1477|AAF58517.1|  126|Drosophila melanogaster CG8510-PA
           protein.
          Length = 126

 Score = 35.9 bits (79), Expect = 0.038
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = +2

Query: 284 QYEDYDAHPKYAFEYKIED----PHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYS 451
           Q  + + + KY + Y+++D       G LKS +   +G+ V G YS    DG   VV Y+
Sbjct: 25  QESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYT 84

Query: 452 AEQ 460
           A++
Sbjct: 85  ADE 87


>AY070997-1|AAL48619.1|  144|Drosophila melanogaster RE08808p
           protein.
          Length = 144

 Score = 35.1 bits (77), Expect = 0.067
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 2/64 (3%)
 Frame = +2

Query: 275 DQPQYEDY-DAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSI-RVVEY 448
           ++ +YE Y + + +Y+F   ++D       S++E R+G  V+G YS    DG + R VEY
Sbjct: 30  EREEYEKYQNENAQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRVEY 87

Query: 449 SAEQ 460
            A++
Sbjct: 88  IADK 91


>AE013599-1904|AAF58238.1|  144|Drosophila melanogaster CG10112-PA
           protein.
          Length = 144

 Score = 35.1 bits (77), Expect = 0.067
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 2/64 (3%)
 Frame = +2

Query: 275 DQPQYEDY-DAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSI-RVVEY 448
           ++ +YE Y + + +Y+F   ++D       S++E R+G  V+G YS    DG + R VEY
Sbjct: 30  EREEYEKYQNENAQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRVEY 87

Query: 449 SAEQ 460
            A++
Sbjct: 88  IADK 91


>AF106677-1|AAD05225.1|  693|Drosophila melanogaster dissatisfaction
           protein.
          Length = 693

 Score = 32.3 bits (70), Expect = 0.47
 Identities = 15/50 (30%), Positives = 21/50 (42%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHHETRQYIMETSLN 287
           H     H +    +H    AAHH A    AA  L HHH      + T+++
Sbjct: 117 HHAAAAHHHHHHHHHAHAAAAHHAAVAAAAASGLHHHHHAMPVSLVTNVS 166


>AE014134-989|AAF52303.1|  691|Drosophila melanogaster CG9019-PA
           protein.
          Length = 691

 Score = 32.3 bits (70), Expect = 0.47
 Identities = 15/50 (30%), Positives = 21/50 (42%)
 Frame = +3

Query: 138 HDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHHETRQYIMETSLN 287
           H     H +    +H    AAHH A    AA  L HHH      + T+++
Sbjct: 117 HHAAAAHHHHHHHHHAHAAAAHHAAVAAAAASGLHHHHHAMPVSLVTNVS 166


>AE014297-4062|AAF56660.2|  366|Drosophila melanogaster CG6131-PA
           protein.
          Length = 366

 Score = 31.5 bits (68), Expect = 0.82
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = +2

Query: 233 RARASP*NAPVHHGDQ----PQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKG 400
           RA A+P  A     D      Q   ++    Y + Y+  D   G  K + +   G+V KG
Sbjct: 41  RANAAPARAEAPRADPVAILKQINKHNEDGSYTYGYEGAD---GSFKIETKLATGEV-KG 96

Query: 401 YYSLHEADGSIRVVEYSAEQ 460
            Y   +  G +RVVEY A +
Sbjct: 97  KYGYVDETGKVRVVEYGANK 116


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,202,514
Number of Sequences: 53049
Number of extensions: 546054
Number of successful extensions: 2095
Number of sequences better than 10.0: 93
Number of HSP's better than 10.0 without gapping: 1977
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2095
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2213979693
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).