SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X69045-1|CAA48790.1|  402|Drosophila melanogaster eukaryotic tra...   184   9e-47
AY121623-1|AAM51950.1|  403|Drosophila melanogaster GH17619p pro...   184   1e-46
AY069283-1|AAL39428.1|  403|Drosophila melanogaster GM14109p pro...   184   1e-46
AF145621-1|AAD38596.1|  403|Drosophila melanogaster eukaryotic i...   184   1e-46
AE014134-1011|AAN10568.1|  403|Drosophila melanogaster CG9075-PD...   184   1e-46
AE014134-1010|AAN10567.1|  403|Drosophila melanogaster CG9075-PB...   184   1e-46
AE014134-1009|AAN10566.1|  403|Drosophila melanogaster CG9075-PC...   184   1e-46
AE014134-1008|AAF52317.2|  403|Drosophila melanogaster CG9075-PA...   184   1e-46
AY089635-1|AAL90373.1|  399|Drosophila melanogaster RE50350p pro...   173   2e-43
AE014297-735|AAF54221.1|  399|Drosophila melanogaster CG7483-PA ...   173   2e-43
M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase p...    75   1e-13
AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p pro...    75   1e-13
AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB...    75   1e-13
AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA...    75   1e-13
AY102660-1|AAM27489.1|  818|Drosophila melanogaster GH10652p pro...    64   2e-10
AE014296-1163|AAF50635.2|  818|Drosophila melanogaster CG10077-P...    64   2e-10
AY121677-1|AAM52004.1|  507|Drosophila melanogaster RE27528p pro...    62   6e-10
AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD0556...    62   6e-10
AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA...    62   6e-10
AE014134-3342|AAF53963.1|  507|Drosophila melanogaster CG9253-PA...    62   6e-10
AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box hel...    62   8e-10
X79802-1|CAA56197.1|  424|Drosophila melanogaster WM6 protein.         61   1e-09
L06018-1|AAB65835.1|  424|Drosophila melanogaster DECD family pu...    61   1e-09
AY118921-1|AAM50781.1|  424|Drosophila melanogaster LD23644p pro...    61   1e-09
AE014134-934|AAN10545.1|  424|Drosophila melanogaster CG7269-PC,...    61   1e-09
AE014134-933|AAN10544.1|  424|Drosophila melanogaster CG7269-PB,...    61   1e-09
AE014134-932|AAF52261.1|  424|Drosophila melanogaster CG7269-PA,...    61   1e-09
AY060404-1|AAL25443.1|  945|Drosophila melanogaster LD32873p pro...    59   6e-09
AE014298-1087|AAF46295.1|  945|Drosophila melanogaster CG10777-P...    59   6e-09
X52846-1|CAA37037.1|  575|Drosophila melanogaster protein ( Dros...    56   5e-08
BT015209-1|AAT94438.1|  575|Drosophila melanogaster RE56857p pro...    56   5e-08
BT011476-1|AAR99134.1|  719|Drosophila melanogaster RE11923p pro...    56   5e-08
BT001716-1|AAN71471.1|  578|Drosophila melanogaster RE68337p pro...    56   5e-08
AY051831-1|AAK93255.1|  703|Drosophila melanogaster LD33749p pro...    56   5e-08
AE014297-394|AAG22212.1|  578|Drosophila melanogaster CG10279-PF...    56   5e-08
AE014297-393|AAN14332.1|  578|Drosophila melanogaster CG10279-PC...    56   5e-08
AE014297-392|AAF51926.2|  578|Drosophila melanogaster CG10279-PB...    56   5e-08
AE014297-391|AAF51927.2|  578|Drosophila melanogaster CG10279-PE...    56   5e-08
AE014297-390|AAN14331.1|  575|Drosophila melanogaster CG10279-PD...    56   5e-08
AE014297-389|AAG22213.2|  719|Drosophila melanogaster CG10279-PA...    56   5e-08
BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p pro...    56   7e-08
AY058515-1|AAL13744.1|  680|Drosophila melanogaster LD21880p pro...    56   7e-08
AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA...    56   7e-08
AY089613-1|AAL90351.1|  798|Drosophila melanogaster RE28061p pro...    55   9e-08
AE014297-778|AAF54262.1|  798|Drosophila melanogaster CG9748-PA ...    55   9e-08
AY061400-1|AAL28948.1|  791|Drosophila melanogaster LD32732p pro...    54   2e-07
AE014296-1853|AAF50131.1|  791|Drosophila melanogaster CG6418-PB...    54   2e-07
Z23266-1|CAA80804.1|  527|Drosophila melanogaster DEAD-box prote...    54   2e-07
L13612-1|AAA16339.1|  527|Drosophila melanogaster DEAD-box prote...    54   2e-07
AY058728-1|AAL13957.1|  521|Drosophila melanogaster LD47509p pro...    54   2e-07
AE013599-778|AAF58994.1|  521|Drosophila melanogaster CG12759-PA...    54   2e-07
BT021222-1|AAX33370.1|  822|Drosophila melanogaster RH55640p pro...    54   3e-07
AY060822-1|AAL28370.1|  641|Drosophila melanogaster GM01081p pro...    54   3e-07
AE014134-2947|AAF53680.2|  822|Drosophila melanogaster CG10333-P...    54   3e-07
U34773-1|AAC47309.1|  725|Drosophila melanogaster DEAD-box prote...    53   4e-07
AY119661-1|AAM50315.1|  727|Drosophila melanogaster SD05527p pro...    53   4e-07
AE014296-3658|AAF51814.1|  727|Drosophila melanogaster CG9054-PA...    53   4e-07
AY075397-1|AAL68229.1|  827|Drosophila melanogaster LD28101p pro...    52   1e-06
AY051752-1|AAK93176.1|  619|Drosophila melanogaster LD28839p pro...    52   1e-06
AF212866-1|AAF19985.1|  619|Drosophila melanogaster abstrakt pro...    52   1e-06
AF187729-1|AAF04040.1|  614|Drosophila melanogaster DEAD-box pro...    52   1e-06
AE014297-15|AAF52165.1|  619|Drosophila melanogaster CG14637-PA ...    52   1e-06
AE014296-83|AAN11439.1|  827|Drosophila melanogaster CG32344-PA ...    52   1e-06
X12945-1|CAA31405.1|  661|Drosophila melanogaster vasa protein.        51   2e-06
AY084126-1|AAL89864.1|  376|Drosophila melanogaster RE20606p pro...    51   2e-06
AE014134-2564|AAF53438.1|  661|Drosophila melanogaster CG3506-PA...    51   2e-06
M23560-1|AAA29013.1|  648|Drosophila melanogaster protein ( D.me...    50   3e-06
AY071389-1|AAL49011.1|  288|Drosophila melanogaster RE44177p pro...    49   8e-06
AY051513-1|AAK92937.1|  613|Drosophila melanogaster GH16590p pro...    48   2e-05
AE014297-721|AAF54208.1|  613|Drosophila melanogaster CG9630-PA ...    48   2e-05
BT004908-1|AAO49161.1|  782|Drosophila melanogaster LD15481p pro...    47   2e-05
AF181659-1|AAD55444.1|  641|Drosophila melanogaster BcDNA.GM0530...    47   2e-05
AE013599-611|AAF59119.1|  782|Drosophila melanogaster CG2173-PA ...    47   2e-05
BT010296-1|AAQ23614.1|  813|Drosophila melanogaster LD11580p pro...    46   4e-05
AE013599-2990|AAF57487.1|  813|Drosophila melanogaster CG9143-PA...    46   4e-05
AY119628-1|AAM50282.1|  826|Drosophila melanogaster RE19835p pro...    46   8e-05
AE014298-2591|AAF48747.2|  826|Drosophila melanogaster CG5800-PA...    46   8e-05
AF145609-1|AAD38584.1|  974|Drosophila melanogaster BcDNA.GH0283...    45   1e-04
AE014298-2568|AAO41693.1|  975|Drosophila melanogaster CG8611-PB...    45   1e-04
AE014298-2567|AAF48727.2|  974|Drosophila melanogaster CG8611-PA...    45   1e-04
U84552-1|AAC27683.1|  663|Drosophila melanogaster helicase pitch...    44   3e-04
AY119620-1|AAM50274.1|  680|Drosophila melanogaster LD46167p pro...    44   3e-04
AY071402-1|AAL49024.1|  680|Drosophila melanogaster RE48840p pro...    44   3e-04
AY070624-1|AAL48095.1|  560|Drosophila melanogaster RE72861p pro...    44   3e-04
AF017777-10|AAC28406.1|  560|Drosophila melanogaster helicase pr...    44   3e-04
AE014298-3138|AAF50818.2|  560|Drosophila melanogaster CG1666-PA...    44   3e-04
AE014297-3091|AAN13900.2|  680|Drosophila melanogaster CG6375-PB...    44   3e-04
AE014297-3090|AAF55951.2|  680|Drosophila melanogaster CG6375-PA...    44   3e-04
AY113641-1|AAM29646.1|  388|Drosophila melanogaster RH74035p pro...    43   5e-04
AE014296-2963|AAF49303.1|  594|Drosophila melanogaster CG5589-PA...    37   0.026
AY069298-1|AAL39443.1|  157|Drosophila melanogaster HL01868p pro...    36   0.080
AE014296-1164|AAN12065.1|  157|Drosophila melanogaster CG10077-P...    36   0.080
AY058512-1|AAL13741.1|  536|Drosophila melanogaster LD21669p pro...    35   0.14 
AE014134-152|AAF51458.1|  536|Drosophila melanogaster CG3561-PA ...    35   0.14 
BT023900-1|ABA81834.1| 1576|Drosophila melanogaster LP13775p pro...    33   0.32 
AE013599-1871|AAF58260.1|  856|Drosophila melanogaster CG13942-P...    33   0.32 
AY118543-1|AAM49912.1|  705|Drosophila melanogaster LD28410p pro...    32   0.75 
AF241270-1|AAF81195.1|  705|Drosophila melanogaster frizzled 4 p...    32   0.75 
AE014298-1020|AAF46245.2|  705|Drosophila melanogaster CG4626-PB...    32   0.75 
AE014298-1019|AAN09202.1|  705|Drosophila melanogaster CG4626-PA...    32   0.75 
AE014297-2422|AAF55479.3| 2938|Drosophila melanogaster CG33547-P...    32   0.99 
AY069247-1|AAL39392.1|  300|Drosophila melanogaster GM02310p pro...    31   2.3  
AE014298-1088|AAF46296.2|  300|Drosophila melanogaster CG10778-P...    31   2.3  
X62420-1|CAA44286.1| 2515|Drosophila melanogaster tudor protein ...    30   3.0  
AE013599-3155|AAF46693.1| 2515|Drosophila melanogaster CG9450-PA...    30   3.0  
AE014296-2526|ABC66138.1|  277|Drosophila melanogaster CG33985-P...    30   4.0  
AE014134-231|AAF51393.1|   80|Drosophila melanogaster CG5011-PA ...    30   4.0  
BT021344-1|AAX33492.1|  431|Drosophila melanogaster LP21640p pro...    29   7.0  
AE014298-1416|AAF46559.1| 1161|Drosophila melanogaster CG15311-P...    29   7.0  
AE014134-1311|AAF52538.2|  429|Drosophila melanogaster CG7025-PA...    29   7.0  
BT021287-1|AAX33435.1|  826|Drosophila melanogaster RE31991p pro...    29   9.2  
AY118641-1|AAM50010.1|  678|Drosophila melanogaster SD02507p pro...    29   9.2  
AY118351-1|AAM48380.1|  182|Drosophila melanogaster LP11479p pro...    29   9.2  
AE014297-3885|AAF56538.1|  613|Drosophila melanogaster CG14540-P...    29   9.2  
AE014296-876|AAF47919.1|   92|Drosophila melanogaster CG13719-PA...    29   9.2  
AE014296-161|AAF47434.1|  841|Drosophila melanogaster CG13908-PA...    29   9.2  
AE014134-2952|AAF53685.2|  826|Drosophila melanogaster CG31790-P...    29   9.2  

>X69045-1|CAA48790.1|  402|Drosophila melanogaster eukaryotic
           translation initiationfactor 4A (eIF-4A) protein.
          Length = 402

 Score =  184 bits (449), Expect = 9e-47
 Identities = 111/207 (53%), Positives = 134/207 (64%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNV
Sbjct: 79  GKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNV 138

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMSS 357
           RED R LESG HVVVGTPGRVYDMI   R + T   ++ L  L +    +SR  +  +  
Sbjct: 139 REDARILESGCHVVVGTPGRVYDMI--NRKLRT--QYIKLFVLDEADEMLSRGFKDQIQD 194

Query: 358 RFCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNNF-TCIELEEW 528
            F  L       LL   M     +          + L +++ L  + +  F   ++ E W
Sbjct: 195 VFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENW 254

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL TLCDLYDTLSI Q+VIFCNTRRKV
Sbjct: 255 KLGTLCDLYDTLSITQSVIFCNTRRKV 281



 Score =  148 bits (359), Expect = 7e-36
 Identities = 93/174 (53%), Positives = 111/174 (63%), Gaps = 2/174 (1%)
 Frame = +3

Query: 249 YDT-RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEV 425
           YD   R L    IKLFVLDEADEMLSRGFKDQI DVFK+L  DVQVILLSATMP DVLEV
Sbjct: 160 YDMINRKLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEV 219

Query: 426 SRCFMRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQ 605
           SRCFMRDPV ILV+KEELTLEGIKQFY++ +++           Y     + + +   ++
Sbjct: 220 SRCFMRDPVSILVKKEELTLEGIKQFYVN-VKQENWKLGTLCDLYDTLSITQSVIFCNTR 278

Query: 606 GGIGSLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
             +  L   + +    +  M GDM+QR+ EVIMK        V   TTDL ARG
Sbjct: 279 RKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVL-ITTDLLARG 331



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIHCLL---HKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N K  +WKL   C ++  L     + F  T   + D LT+ M + +FTVSAMHG
Sbjct: 247 VNVKQENWKLGTLCDLYDTLSITQSVIFCNTR-RKVDQLTQEMSIHNFTVSAMHG 300


>AY121623-1|AAM51950.1|  403|Drosophila melanogaster GH17619p
           protein.
          Length = 403

 Score =  184 bits (448), Expect = 1e-46
 Identities = 109/207 (52%), Positives = 132/207 (63%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNV
Sbjct: 79  GKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNV 138

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMSS 357
           RED R LESG HVVVGTPGRVYDMI         + ++ L  L +    +SR  +  +  
Sbjct: 139 REDARILESGCHVVVGTPGRVYDMI---NRKVLRTQYIKLFVLDEADEMLSRGFKDQIQD 195

Query: 358 RFCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNNF-TCIELEEW 528
            F  L       LL   M     +          + L +++ L  + +  F   ++ E W
Sbjct: 196 VFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENW 255

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL TLCDLYDTLSI Q+VIFCNTRRKV
Sbjct: 256 KLGTLCDLYDTLSITQSVIFCNTRRKV 282



 Score =  149 bits (361), Expect = 4e-36
 Identities = 91/170 (53%), Positives = 110/170 (64%), Gaps = 1/170 (0%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L    IKLFVLDEADEMLSRGFKDQI DVFK+L  DVQVILLSATMP DVLEVSRCF
Sbjct: 165 RKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCF 224

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDPV ILV+KEELTLEGIKQFY++ +++           Y     + + +   ++  + 
Sbjct: 225 MRDPVSILVKKEELTLEGIKQFYVN-VKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVD 283

Query: 618 SLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
            L   + +    +  M GDM+QR+ EVIMK        V   TTDL ARG
Sbjct: 284 QLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVL-ITTDLLARG 332



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIHCLL---HKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N K  +WKL   C ++  L     + F  T   + D LT+ M + +FTVSAMHG
Sbjct: 248 VNVKQENWKLGTLCDLYDTLSITQSVIFCNTR-RKVDQLTQEMSIHNFTVSAMHG 301


>AY069283-1|AAL39428.1|  403|Drosophila melanogaster GM14109p
           protein.
          Length = 403

 Score =  184 bits (448), Expect = 1e-46
 Identities = 109/207 (52%), Positives = 132/207 (63%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNV
Sbjct: 79  GKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNV 138

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMSS 357
           RED R LESG HVVVGTPGRVYDMI         + ++ L  L +    +SR  +  +  
Sbjct: 139 REDARILESGCHVVVGTPGRVYDMI---NRKVLRTQYIKLFVLDEADEMLSRGFKDQIQD 195

Query: 358 RFCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNNF-TCIELEEW 528
            F  L       LL   M     +          + L +++ L  + +  F   ++ E W
Sbjct: 196 VFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENW 255

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL TLCDLYDTLSI Q+VIFCNTRRKV
Sbjct: 256 KLGTLCDLYDTLSITQSVIFCNTRRKV 282



 Score =  149 bits (361), Expect = 4e-36
 Identities = 91/170 (53%), Positives = 110/170 (64%), Gaps = 1/170 (0%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L    IKLFVLDEADEMLSRGFKDQI DVFK+L  DVQVILLSATMP DVLEVSRCF
Sbjct: 165 RKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCF 224

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDPV ILV+KEELTLEGIKQFY++ +++           Y     + + +   ++  + 
Sbjct: 225 MRDPVSILVKKEELTLEGIKQFYVN-VKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVD 283

Query: 618 SLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
            L   + +    +  M GDM+QR+ EVIMK        V   TTDL ARG
Sbjct: 284 QLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVL-ITTDLLARG 332



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIHCLL---HKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N K  +WKL   C ++  L     + F  T   + D LT+ M + +FTVSAMHG
Sbjct: 248 VNVKQENWKLGTLCDLYDTLSITQSVIFCNTR-RKVDQLTQEMSIHNFTVSAMHG 301


>AF145621-1|AAD38596.1|  403|Drosophila melanogaster eukaryotic
           initiation factor-4a protein.
          Length = 403

 Score =  184 bits (448), Expect = 1e-46
 Identities = 109/207 (52%), Positives = 132/207 (63%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNV
Sbjct: 79  GKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNV 138

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMSS 357
           RED R LESG HVVVGTPGRVYDMI         + ++ L  L +    +SR  +  +  
Sbjct: 139 REDARILESGCHVVVGTPGRVYDMI---NRKVLRTQYIKLFVLDEADEMLSRGFKDQIQD 195

Query: 358 RFCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNNF-TCIELEEW 528
            F  L       LL   M     +          + L +++ L  + +  F   ++ E W
Sbjct: 196 VFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENW 255

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL TLCDLYDTLSI Q+VIFCNTRRKV
Sbjct: 256 KLGTLCDLYDTLSITQSVIFCNTRRKV 282



 Score =  149 bits (361), Expect = 4e-36
 Identities = 91/170 (53%), Positives = 110/170 (64%), Gaps = 1/170 (0%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L    IKLFVLDEADEMLSRGFKDQI DVFK+L  DVQVILLSATMP DVLEVSRCF
Sbjct: 165 RKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCF 224

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDPV ILV+KEELTLEGIKQFY++ +++           Y     + + +   ++  + 
Sbjct: 225 MRDPVSILVKKEELTLEGIKQFYVN-VKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVD 283

Query: 618 SLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
            L   + +    +  M GDM+QR+ EVIMK        V   TTDL ARG
Sbjct: 284 QLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVL-ITTDLLARG 332



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIHCLL---HKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N K  +WKL   C ++  L     + F  T   + D LT+ M + +FTVSAMHG
Sbjct: 248 VNVKQENWKLGTLCDLYDTLSITQSVIFCNTR-RKVDQLTQEMSIHNFTVSAMHG 301


>AE014134-1011|AAN10568.1|  403|Drosophila melanogaster CG9075-PD,
           isoform D protein.
          Length = 403

 Score =  184 bits (448), Expect = 1e-46
 Identities = 109/207 (52%), Positives = 132/207 (63%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNV
Sbjct: 79  GKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNV 138

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMSS 357
           RED R LESG HVVVGTPGRVYDMI         + ++ L  L +    +SR  +  +  
Sbjct: 139 REDARILESGCHVVVGTPGRVYDMI---NRKVLRTQYIKLFVLDEADEMLSRGFKDQIQD 195

Query: 358 RFCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNNF-TCIELEEW 528
            F  L       LL   M     +          + L +++ L  + +  F   ++ E W
Sbjct: 196 VFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENW 255

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL TLCDLYDTLSI Q+VIFCNTRRKV
Sbjct: 256 KLGTLCDLYDTLSITQSVIFCNTRRKV 282



 Score =  149 bits (361), Expect = 4e-36
 Identities = 91/170 (53%), Positives = 110/170 (64%), Gaps = 1/170 (0%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L    IKLFVLDEADEMLSRGFKDQI DVFK+L  DVQVILLSATMP DVLEVSRCF
Sbjct: 165 RKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCF 224

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDPV ILV+KEELTLEGIKQFY++ +++           Y     + + +   ++  + 
Sbjct: 225 MRDPVSILVKKEELTLEGIKQFYVN-VKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVD 283

Query: 618 SLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
            L   + +    +  M GDM+QR+ EVIMK        V   TTDL ARG
Sbjct: 284 QLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVL-ITTDLLARG 332



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIHCLL---HKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N K  +WKL   C ++  L     + F  T   + D LT+ M + +FTVSAMHG
Sbjct: 248 VNVKQENWKLGTLCDLYDTLSITQSVIFCNTR-RKVDQLTQEMSIHNFTVSAMHG 301


>AE014134-1010|AAN10567.1|  403|Drosophila melanogaster CG9075-PB,
           isoform B protein.
          Length = 403

 Score =  184 bits (448), Expect = 1e-46
 Identities = 109/207 (52%), Positives = 132/207 (63%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNV
Sbjct: 79  GKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNV 138

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMSS 357
           RED R LESG HVVVGTPGRVYDMI         + ++ L  L +    +SR  +  +  
Sbjct: 139 REDARILESGCHVVVGTPGRVYDMI---NRKVLRTQYIKLFVLDEADEMLSRGFKDQIQD 195

Query: 358 RFCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNNF-TCIELEEW 528
            F  L       LL   M     +          + L +++ L  + +  F   ++ E W
Sbjct: 196 VFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENW 255

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL TLCDLYDTLSI Q+VIFCNTRRKV
Sbjct: 256 KLGTLCDLYDTLSITQSVIFCNTRRKV 282



 Score =  149 bits (361), Expect = 4e-36
 Identities = 91/170 (53%), Positives = 110/170 (64%), Gaps = 1/170 (0%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L    IKLFVLDEADEMLSRGFKDQI DVFK+L  DVQVILLSATMP DVLEVSRCF
Sbjct: 165 RKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCF 224

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDPV ILV+KEELTLEGIKQFY++ +++           Y     + + +   ++  + 
Sbjct: 225 MRDPVSILVKKEELTLEGIKQFYVN-VKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVD 283

Query: 618 SLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
            L   + +    +  M GDM+QR+ EVIMK        V   TTDL ARG
Sbjct: 284 QLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVL-ITTDLLARG 332



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIHCLL---HKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N K  +WKL   C ++  L     + F  T   + D LT+ M + +FTVSAMHG
Sbjct: 248 VNVKQENWKLGTLCDLYDTLSITQSVIFCNTR-RKVDQLTQEMSIHNFTVSAMHG 301


>AE014134-1009|AAN10566.1|  403|Drosophila melanogaster CG9075-PC,
           isoform C protein.
          Length = 403

 Score =  184 bits (448), Expect = 1e-46
 Identities = 109/207 (52%), Positives = 132/207 (63%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNV
Sbjct: 79  GKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNV 138

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMSS 357
           RED R LESG HVVVGTPGRVYDMI         + ++ L  L +    +SR  +  +  
Sbjct: 139 REDARILESGCHVVVGTPGRVYDMI---NRKVLRTQYIKLFVLDEADEMLSRGFKDQIQD 195

Query: 358 RFCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNNF-TCIELEEW 528
            F  L       LL   M     +          + L +++ L  + +  F   ++ E W
Sbjct: 196 VFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENW 255

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL TLCDLYDTLSI Q+VIFCNTRRKV
Sbjct: 256 KLGTLCDLYDTLSITQSVIFCNTRRKV 282



 Score =  149 bits (361), Expect = 4e-36
 Identities = 91/170 (53%), Positives = 110/170 (64%), Gaps = 1/170 (0%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L    IKLFVLDEADEMLSRGFKDQI DVFK+L  DVQVILLSATMP DVLEVSRCF
Sbjct: 165 RKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCF 224

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDPV ILV+KEELTLEGIKQFY++ +++           Y     + + +   ++  + 
Sbjct: 225 MRDPVSILVKKEELTLEGIKQFYVN-VKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVD 283

Query: 618 SLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
            L   + +    +  M GDM+QR+ EVIMK        V   TTDL ARG
Sbjct: 284 QLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVL-ITTDLLARG 332



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIHCLL---HKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N K  +WKL   C ++  L     + F  T   + D LT+ M + +FTVSAMHG
Sbjct: 248 VNVKQENWKLGTLCDLYDTLSITQSVIFCNTR-RKVDQLTQEMSIHNFTVSAMHG 301


>AE014134-1008|AAF52317.2|  403|Drosophila melanogaster CG9075-PA,
           isoform A protein.
          Length = 403

 Score =  184 bits (448), Expect = 1e-46
 Identities = 109/207 (52%), Positives = 132/207 (63%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI+ILQQIDTSIRECQALILAPTRELA QIQ+VV+ALG+++    HACIGGTNV
Sbjct: 79  GKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNV 138

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMSS 357
           RED R LESG HVVVGTPGRVYDMI         + ++ L  L +    +SR  +  +  
Sbjct: 139 REDARILESGCHVVVGTPGRVYDMI---NRKVLRTQYIKLFVLDEADEMLSRGFKDQIQD 195

Query: 358 RFCQLMFKSYYSLLPCLMM--YWKYLDAL*EILYAYLYRRKSLPWKVLNNF-TCIELEEW 528
            F  L       LL   M     +          + L +++ L  + +  F   ++ E W
Sbjct: 196 VFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENW 255

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL TLCDLYDTLSI Q+VIFCNTRRKV
Sbjct: 256 KLGTLCDLYDTLSITQSVIFCNTRRKV 282



 Score =  149 bits (361), Expect = 4e-36
 Identities = 91/170 (53%), Positives = 110/170 (64%), Gaps = 1/170 (0%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+ L    IKLFVLDEADEMLSRGFKDQI DVFK+L  DVQVILLSATMP DVLEVSRCF
Sbjct: 165 RKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCF 224

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDPV ILV+KEELTLEGIKQFY++ +++           Y     + + +   ++  + 
Sbjct: 225 MRDPVSILVKKEELTLEGIKQFYVN-VKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVD 283

Query: 618 SLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
            L   + +    +  M GDM+QR+ EVIMK        V   TTDL ARG
Sbjct: 284 QLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVL-ITTDLLARG 332



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIHCLL---HKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N K  +WKL   C ++  L     + F  T   + D LT+ M + +FTVSAMHG
Sbjct: 248 VNVKQENWKLGTLCDLYDTLSITQSVIFCNTR-RKVDQLTQEMSIHNFTVSAMHG 301


>AY089635-1|AAL90373.1|  399|Drosophila melanogaster RE50350p
           protein.
          Length = 399

 Score =  173 bits (422), Expect = 2e-43
 Identities = 101/214 (47%), Positives = 133/214 (62%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSISILQ +DT++RE Q L L+PTRELA QIQKV++ALGD +N +CH CIGGTN+
Sbjct: 75  GKTATFSISILQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNL 134

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G H+V GTPGRV+DMI   R + T +     +K++     +     M++  
Sbjct: 135 GEDIRKLDYGQHIVSGTPGRVFDMI-KRRVLRTRA-----IKML----VLDEADEMLNKG 184

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 185 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFV 244

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 245 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 278



 Score =  116 bits (278), Expect = 5e-26
 Identities = 68/169 (40%), Positives = 98/169 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+ VLDEADEML++GFK+QI+DV++ L    QV+L+SAT+P ++LE++  F
Sbjct: 161 RRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTSKF 220

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 221 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 280

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E + IMK        V   TTD+WARG
Sbjct: 281 LTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVL-ITTDVWARG 328



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 279 DWLTEKMREANFTVSSMHG 297


>AE014297-735|AAF54221.1|  399|Drosophila melanogaster CG7483-PA
           protein.
          Length = 399

 Score =  173 bits (422), Expect = 2e-43
 Identities = 101/214 (47%), Positives = 133/214 (62%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSISILQ +DT++RE Q L L+PTRELA QIQKV++ALGD +N +CH CIGGTN+
Sbjct: 75  GKTATFSISILQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNL 134

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G H+V GTPGRV+DMI   R + T +     +K++     +     M++  
Sbjct: 135 GEDIRKLDYGQHIVSGTPGRVFDMI-KRRVLRTRA-----IKML----VLDEADEMLNKG 184

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 185 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFV 244

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 245 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 278



 Score =  116 bits (278), Expect = 5e-26
 Identities = 68/169 (40%), Positives = 98/169 (57%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+ VLDEADEML++GFK+QI+DV++ L    QV+L+SAT+P ++LE++  F
Sbjct: 161 RRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTSKF 220

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 221 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 280

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E + IMK        V   TTD+WARG
Sbjct: 281 LTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVL-ITTDVWARG 328



 Score = 33.1 bits (72), Expect = 0.43
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 279 DWLTEKMREANFTVSSMHG 297


>M59926-1|AAA28603.1|  459|Drosophila melanogaster RNA helicase
           protein.
          Length = 459

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 33/85 (38%), Positives = 54/85 (63%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + I +L+QID +    QAL++ PTRELA Q  ++ I L  HL+ +     GGT +
Sbjct: 107 GKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTIL 166

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           ++DI ++   V +++ TPGR+ D++
Sbjct: 167 KDDILRIYQKVQLIIATPGRILDLM 191



 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 44/74 (59%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           ++ VLDEAD++LS  F+  +  V   L  D Q++L SAT P  V       +R+P  I +
Sbjct: 202 RILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINL 261

Query: 465 QKEELTLEGIKQFY 506
             EELTL+G+ Q+Y
Sbjct: 262 M-EELTLKGVTQYY 274



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 472 KSLPWKVLNNFTCIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
           + L  K +  +     E  K+  L  L+  L I Q++IFCN+ ++V L
Sbjct: 263 EELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVEL 310


>AY051663-1|AAK93087.1|  459|Drosophila melanogaster LD21247p
           protein.
          Length = 459

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 33/85 (38%), Positives = 54/85 (63%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + I +L+QID +    QAL++ PTRELA Q  ++ I L  HL+ +     GGT +
Sbjct: 107 GKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTIL 166

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           ++DI ++   V +++ TPGR+ D++
Sbjct: 167 KDDILRIYQKVQLIIATPGRILDLM 191



 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 44/74 (59%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           ++ VLDEAD++LS  F+  +  V   L  D Q++L SAT P  V       +R+P  I +
Sbjct: 202 RILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINL 261

Query: 465 QKEELTLEGIKQFY 506
             EELTL+G+ Q+Y
Sbjct: 262 M-EELTLKGVTQYY 274



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 472 KSLPWKVLNNFTCIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
           + L  K +  +     E  K+  L  L+  L I Q++IFCN+ ++V L
Sbjct: 263 EELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVEL 310


>AE014134-1792|AAN10728.1|  428|Drosophila melanogaster CG4916-PB,
           isoform B protein.
          Length = 428

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 33/85 (38%), Positives = 54/85 (63%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + I +L+QID +    QAL++ PTRELA Q  ++ I L  HL+ +     GGT +
Sbjct: 76  GKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTIL 135

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           ++DI ++   V +++ TPGR+ D++
Sbjct: 136 KDDILRIYQKVQLIIATPGRILDLM 160



 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 44/74 (59%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           ++ VLDEAD++LS  F+  +  V   L  D Q++L SAT P  V       +R+P  I +
Sbjct: 171 RILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINL 230

Query: 465 QKEELTLEGIKQFY 506
             EELTL+G+ Q+Y
Sbjct: 231 M-EELTLKGVTQYY 243



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 472 KSLPWKVLNNFTCIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
           + L  K +  +     E  K+  L  L+  L I Q++IFCN+ ++V L
Sbjct: 232 EELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVEL 279


>AE014134-1791|AAF52881.2|  459|Drosophila melanogaster CG4916-PA,
           isoform A protein.
          Length = 459

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 33/85 (38%), Positives = 54/85 (63%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  + I +L+QID +    QAL++ PTRELA Q  ++ I L  HL+ +     GGT +
Sbjct: 107 GKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTIL 166

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
           ++DI ++   V +++ TPGR+ D++
Sbjct: 167 KDDILRIYQKVQLIIATPGRILDLM 191



 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 44/74 (59%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILV 464
           ++ VLDEAD++LS  F+  +  V   L  D Q++L SAT P  V       +R+P  I +
Sbjct: 202 RILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINL 261

Query: 465 QKEELTLEGIKQFY 506
             EELTL+G+ Q+Y
Sbjct: 262 M-EELTLKGVTQYY 274



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 472 KSLPWKVLNNFTCIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
           + L  K +  +     E  K+  L  L+  L I Q++IFCN+ ++V L
Sbjct: 263 EELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVEL 310


>AY102660-1|AAM27489.1|  818|Drosophila melanogaster GH10652p
           protein.
          Length = 818

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 30/63 (47%), Positives = 40/63 (63%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V I  G + + +     GG    +  R LE GV +V+ TPGR+ 
Sbjct: 233 ALVLAPTRELAQQIQQVAIEFGSNTHVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLI 292

Query: 247 DMI 255
           D +
Sbjct: 293 DFL 295



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 21/55 (38%), Positives = 36/55 (65%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           VLDEAD ML  GF+ QI  + + +  D QV++ SAT P +V +++  F+ + +++
Sbjct: 309 VLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQV 363


>AE014296-1163|AAF50635.2|  818|Drosophila melanogaster CG10077-PA,
           isoform A protein.
          Length = 818

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 30/63 (47%), Positives = 40/63 (63%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V I  G + + +     GG    +  R LE GV +V+ TPGR+ 
Sbjct: 233 ALVLAPTRELAQQIQQVAIEFGSNTHVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLI 292

Query: 247 DMI 255
           D +
Sbjct: 293 DFL 295



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 21/55 (38%), Positives = 36/55 (65%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           VLDEAD ML  GF+ QI  + + +  D QV++ SAT P +V +++  F+ + +++
Sbjct: 309 VLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQV 363


>AY121677-1|AAM52004.1|  507|Drosophila melanogaster RE27528p
           protein.
          Length = 507

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 32/83 (38%), Positives = 47/83 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  KC   +GG ++
Sbjct: 110 GKTGAFALPILHALLENPQRYFALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDM 169

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                QL    H+++ TPGR+ D
Sbjct: 170 VAQGLQLAKKPHIIIATPGRLVD 192



 Score = 58.4 bits (135), Expect = 1e-08
 Identities = 26/86 (30%), Positives = 50/86 (58%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   IK  V+DEAD +L+  F+ ++  + K+L  + +  L SATM   V ++ R
Sbjct: 195 ENMKGFNLKAIKYLVMDEADRILNMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQR 254

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             ++DPV++ V  +  T+E ++Q Y+
Sbjct: 255 ASLKDPVKVEVSNKYQTVEQLQQSYL 280


>AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD05563
           protein.
          Length = 1028

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL-GDHLNAKCHACIGGTN 177
           GKT  + I+++Q  + +I +  A+I+ PTRELA Q+Q     L     + KC A IGGT+
Sbjct: 74  GKTLIYVIAVVQSFNPNINQPHAMIVVPTRELAIQVQDTFFHLCKSFRDFKCSAFIGGTD 133

Query: 178 VREDIRQLESGVHVVVGTPGRV 243
           V +D +++     V++GTPGR+
Sbjct: 134 VAKDRKRMNES-RVIIGTPGRL 154



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSA---DVQVILLSATMPDDVLEVSR 431
           R    + ++L VLDEAD++     K   H V K++ A   + Q+I  SAT   ++ E   
Sbjct: 161 RVFDVSKLRLLVLDEADQLYQT--KSLQHTVSKLIEAMPKNRQIIACSATYDQNLDERLA 218

Query: 432 CFMRDPVRILVQKEELTLEGIKQF 503
             M  P+ I   +    L GI+QF
Sbjct: 219 KVMDKPMLISNSERATVLLGIRQF 242


>AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA
           protein.
          Length = 1028

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL-GDHLNAKCHACIGGTN 177
           GKT  + I+++Q  + +I +  A+I+ PTRELA Q+Q     L     + KC A IGGT+
Sbjct: 74  GKTLIYVIAVVQSFNPNINQPHAMIVVPTRELAIQVQDTFFHLCKSFRDFKCSAFIGGTD 133

Query: 178 VREDIRQLESGVHVVVGTPGRV 243
           V +D +++     V++GTPGR+
Sbjct: 134 VAKDRKRMNES-RVIIGTPGRL 154



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSA---DVQVILLSATMPDDVLEVSR 431
           R    + ++L VLDEAD++     K   H V K++ A   + Q+I  SAT   ++ E   
Sbjct: 161 RVFDVSKLRLLVLDEADQLYQT--KSLQHTVSKLIEAMPKNRQIIACSATYDQNLDERLA 218

Query: 432 CFMRDPVRILVQKEELTLEGIKQF 503
             M  P+ I   +    L GI+QF
Sbjct: 219 KVMDKPMLISNSERATVLLGIRQF 242


>AE014134-3342|AAF53963.1|  507|Drosophila melanogaster CG9253-PA
           protein.
          Length = 507

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 32/83 (38%), Positives = 47/83 (56%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  KC   +GG ++
Sbjct: 110 GKTGAFALPILHALLENPQRYFALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDM 169

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                QL    H+++ TPGR+ D
Sbjct: 170 VAQGLQLAKKPHIIIATPGRLVD 192



 Score = 58.4 bits (135), Expect = 1e-08
 Identities = 26/86 (30%), Positives = 50/86 (58%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   IK  V+DEAD +L+  F+ ++  + K+L  + +  L SATM   V ++ R
Sbjct: 195 ENMKGFNLKAIKYLVMDEADRILNMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQR 254

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             ++DPV++ V  +  T+E ++Q Y+
Sbjct: 255 ASLKDPVKVEVSNKYQTVEQLQQSYL 280


>AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box
           helicase protein.
          Length = 460

 Score = 62.1 bits (144), Expect = 8e-10
 Identities = 32/84 (38%), Positives = 51/84 (60%), Gaps = 1/84 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R      I +FVLDEAD M++ +G  DQ   + K+L+   Q++  SAT   +V++ +R  
Sbjct: 210 RLFDMKKISVFVLDEADVMIATQGHHDQCIRIHKMLNPHCQMLFFSATYGKEVMDFARLI 269

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           + DP  I + +EE +LE IKQ+Y+
Sbjct: 270 VADPTIIRLMREEESLENIKQYYV 293



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 51/209 (24%), Positives = 96/209 (45%), Gaps = 8/209 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +++L +++  +   Q L L+PT ELA Q  +V   +G      K    + G  
Sbjct: 124 GKTAAFVLAMLSRVNVCLNHPQVLCLSPTYELAIQTGEVAARMGQFCREIKLRFAVRGEE 183

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCC-------PEVSR 336
           V +  +++E   H+++GTPG++ D  +  R        +F++              +  R
Sbjct: 184 V-DRSKKIEE--HILIGTPGKLLDWGIKFRLFDMKKISVFVLDEADVMIATQGHHDQCIR 240

Query: 337 TRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIE 516
              M++     L F + Y     +M + + + A   I+   L R +     +   +   +
Sbjct: 241 IHKMLNPHCQMLFFSATYG--KEVMDFARLIVADPTII--RLMREEESLENIKQYYVKCK 296

Query: 517 LEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
            EE K   + ++Y  +S+ QA+IFC+T+R
Sbjct: 297 NEEGKYNAIQNIYGCISVGQAIIFCHTKR 325


>X79802-1|CAA56197.1|  424|Drosophila melanogaster WM6 protein.
          Length = 424

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGT 174
           GKTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG 
Sbjct: 90  GKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGM 149

Query: 175 NVREDIRQLESGV-HVVVGTPGRVYDMI 255
            +++D   L+SG  H+VVGTPGR+  +I
Sbjct: 150 AIQKDEETLKSGTPHIVVGTPGRILALI 177



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + L+   +K FVLDE D+ML +   +  + ++F+      QV++ SAT+  D+  V + F
Sbjct: 180 KKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKF 239

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYMH 512
           M+DP+ + V  E +LTL G++Q Y++
Sbjct: 240 MQDPMEVYVDDEAKLTLHGLQQHYVN 265


>L06018-1|AAB65835.1|  424|Drosophila melanogaster DECD family
           putative RNA helicase protein.
          Length = 424

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGT 174
           GKTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG 
Sbjct: 90  GKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGM 149

Query: 175 NVREDIRQLESGV-HVVVGTPGRVYDMI 255
            +++D   L+SG  H+VVGTPGR+  +I
Sbjct: 150 AIQKDEETLKSGTPHIVVGTPGRILALI 177



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + L+   +K FVLDE D+ML +   +  + ++F+      QV++ SAT+  D+  V + F
Sbjct: 180 KKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKF 239

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYMH 512
           M+DP+ + V  E +LTL G++Q Y++
Sbjct: 240 MQDPMEVYVDDEAKLTLHGLQQHYVN 265


>AY118921-1|AAM50781.1|  424|Drosophila melanogaster LD23644p
           protein.
          Length = 424

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGT 174
           GKTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG 
Sbjct: 90  GKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGM 149

Query: 175 NVREDIRQLESGV-HVVVGTPGRVYDMI 255
            +++D   L+SG  H+VVGTPGR+  +I
Sbjct: 150 AIQKDEETLKSGTPHIVVGTPGRILALI 177



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + L+   +K FVLDE D+ML +   +  + ++F+      QV++ SAT+  D+  V + F
Sbjct: 180 KKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKF 239

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYMH 512
           M+DP+ + V  E +LTL G++Q Y++
Sbjct: 240 MQDPMEVYVDDEAKLTLHGLQQHYVN 265


>AE014134-934|AAN10545.1|  424|Drosophila melanogaster CG7269-PC,
           isoform C protein.
          Length = 424

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGT 174
           GKTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG 
Sbjct: 90  GKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGM 149

Query: 175 NVREDIRQLESGV-HVVVGTPGRVYDMI 255
            +++D   L+SG  H+VVGTPGR+  +I
Sbjct: 150 AIQKDEETLKSGTPHIVVGTPGRILALI 177



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + L+   +K FVLDE D+ML +   +  + ++F+      QV++ SAT+  D+  V + F
Sbjct: 180 KKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKF 239

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYMH 512
           M+DP+ + V  E +LTL G++Q Y++
Sbjct: 240 MQDPMEVYVDDEAKLTLHGLQQHYVN 265


>AE014134-933|AAN10544.1|  424|Drosophila melanogaster CG7269-PB,
           isoform B protein.
          Length = 424

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGT 174
           GKTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG 
Sbjct: 90  GKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGM 149

Query: 175 NVREDIRQLESGV-HVVVGTPGRVYDMI 255
            +++D   L+SG  H+VVGTPGR+  +I
Sbjct: 150 AIQKDEETLKSGTPHIVVGTPGRILALI 177



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + L+   +K FVLDE D+ML +   +  + ++F+      QV++ SAT+  D+  V + F
Sbjct: 180 KKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKF 239

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYMH 512
           M+DP+ + V  E +LTL G++Q Y++
Sbjct: 240 MQDPMEVYVDDEAKLTLHGLQQHYVN 265


>AE014134-932|AAF52261.1|  424|Drosophila melanogaster CG7269-PA,
           isoform A protein.
          Length = 424

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGT 174
           GKTA F ++ LQQ++ S    C  L++  TRELA QI K       ++   K     GG 
Sbjct: 90  GKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGM 149

Query: 175 NVREDIRQLESGV-HVVVGTPGRVYDMI 255
            +++D   L+SG  H+VVGTPGR+  +I
Sbjct: 150 AIQKDEETLKSGTPHIVVGTPGRILALI 177



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + L+   +K FVLDE D+ML +   +  + ++F+      QV++ SAT+  D+  V + F
Sbjct: 180 KKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKF 239

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYMH 512
           M+DP+ + V  E +LTL G++Q Y++
Sbjct: 240 MQDPMEVYVDDEAKLTLHGLQQHYVN 265


>AY060404-1|AAL25443.1|  945|Drosophila melanogaster LD32873p
           protein.
          Length = 945

 Score = 59.3 bits (137), Expect = 6e-09
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKC-HACI-GGTNVREDIRQLESGVHVVVGTPGR 240
           AL+LAPTRELAQQIQ VV   G     +  H CI GG++     R L+ GV V++ TPGR
Sbjct: 313 ALVLAPTRELAQQIQSVVRDYGHLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGR 372

Query: 241 VYDMI 255
           + D +
Sbjct: 373 LIDFL 377



 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  + + +  D QV++ SAT P +V  ++  F+ D ++I +   
Sbjct: 391 VLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSM 450

Query: 474 ELT 482
            L+
Sbjct: 451 NLS 453


>AE014298-1087|AAF46295.1|  945|Drosophila melanogaster CG10777-PB
           protein.
          Length = 945

 Score = 59.3 bits (137), Expect = 6e-09
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKC-HACI-GGTNVREDIRQLESGVHVVVGTPGR 240
           AL+LAPTRELAQQIQ VV   G     +  H CI GG++     R L+ GV V++ TPGR
Sbjct: 313 ALVLAPTRELAQQIQSVVRDYGHLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGR 372

Query: 241 VYDMI 255
           + D +
Sbjct: 373 LIDFL 377



 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  + + +  D QV++ SAT P +V  ++  F+ D ++I +   
Sbjct: 391 VLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSM 450

Query: 474 ELT 482
            L+
Sbjct: 451 NLS 453


>X52846-1|CAA37037.1|  575|Drosophila melanogaster protein (
           Drosophila melanogasterRM62 mRNA for novel RNA helicase.
           ).
          Length = 575

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 213 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 272

Query: 247 DMI 255
           D +
Sbjct: 273 DFL 275



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 289 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 348

Query: 474 ELT 482
           EL+
Sbjct: 349 ELS 351


>BT015209-1|AAT94438.1|  575|Drosophila melanogaster RE56857p
           protein.
          Length = 575

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 213 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 272

Query: 247 DMI 255
           D +
Sbjct: 273 DFL 275



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 289 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 348

Query: 474 ELT 482
           EL+
Sbjct: 349 ELS 351


>BT011476-1|AAR99134.1|  719|Drosophila melanogaster RE11923p
           protein.
          Length = 719

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 357 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 416

Query: 247 DMI 255
           D +
Sbjct: 417 DFL 419



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 433 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 492

Query: 474 ELT 482
           EL+
Sbjct: 493 ELS 495


>BT001716-1|AAN71471.1|  578|Drosophila melanogaster RE68337p
           protein.
          Length = 578

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 275

Query: 247 DMI 255
           D +
Sbjct: 276 DFL 278



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 292 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 351

Query: 474 ELT 482
           EL+
Sbjct: 352 ELS 354


>AY051831-1|AAK93255.1|  703|Drosophila melanogaster LD33749p
           protein.
          Length = 703

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           +  +TI   VLDEAD ML  GF+ QI  V   +  D Q I+ SAT P  V  +++ +M++
Sbjct: 426 IDVSTITYLVLDEADRMLDMGFEPQIRKVMLDIRPDRQTIMTSATWPPGVRRLAQSYMKN 485

Query: 447 PVRILVQKEEL-TLEGIKQ 500
           P+++ V   +L     +KQ
Sbjct: 486 PIQVCVGSLDLAATHSVKQ 504



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 26/63 (41%), Positives = 34/63 (53%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELA QI+  V         K     GG N    I  LE G  +++ TPGR+ D
Sbjct: 361 LVLAPTRELALQIEMEVKKYSFR-GMKAVCVYGGGNRNMQISDLERGAEIIICTPGRLND 419

Query: 250 MIL 258
           +I+
Sbjct: 420 LIM 422


>AE014297-394|AAG22212.1|  578|Drosophila melanogaster CG10279-PF,
           isoform F protein.
          Length = 578

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 275

Query: 247 DMI 255
           D +
Sbjct: 276 DFL 278



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 292 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 351

Query: 474 ELT 482
           EL+
Sbjct: 352 ELS 354


>AE014297-393|AAN14332.1|  578|Drosophila melanogaster CG10279-PC,
           isoform C protein.
          Length = 578

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 275

Query: 247 DMI 255
           D +
Sbjct: 276 DFL 278



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 292 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 351

Query: 474 ELT 482
           EL+
Sbjct: 352 ELS 354


>AE014297-392|AAF51926.2|  578|Drosophila melanogaster CG10279-PB,
           isoform B protein.
          Length = 578

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 275

Query: 247 DMI 255
           D +
Sbjct: 276 DFL 278



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 292 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 351

Query: 474 ELT 482
           EL+
Sbjct: 352 ELS 354


>AE014297-391|AAF51927.2|  578|Drosophila melanogaster CG10279-PE,
           isoform E protein.
          Length = 578

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 216 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 275

Query: 247 DMI 255
           D +
Sbjct: 276 DFL 278



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 292 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 351

Query: 474 ELT 482
           EL+
Sbjct: 352 ELS 354


>AE014297-390|AAN14331.1|  575|Drosophila melanogaster CG10279-PD,
           isoform D protein.
          Length = 575

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 213 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 272

Query: 247 DMI 255
           D +
Sbjct: 273 DFL 275



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 289 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 348

Query: 474 ELT 482
           EL+
Sbjct: 349 ELS 351


>AE014297-389|AAG22213.2|  719|Drosophila melanogaster CG10279-PA,
           isoform A protein.
          Length = 719

 Score = 56.0 bits (129), Expect = 5e-08
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           AL+LAPTRELAQQIQ+V    G     +     GG      +R L+ G  +V+ TPGR+ 
Sbjct: 357 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLI 416

Query: 247 DMI 255
           D +
Sbjct: 417 DFL 419



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+ + ++I +   
Sbjct: 433 VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSL 492

Query: 474 ELT 482
           EL+
Sbjct: 493 ELS 495


>BT016090-1|AAV36975.1| 1224|Drosophila melanogaster LD41277p
           protein.
          Length = 1224

 Score = 55.6 bits (128), Expect = 7e-08
 Identities = 32/90 (35%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + + + I    S+ +     A+I+APTREL  QI K +      L  +     
Sbjct: 559 GKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIGKDIRKFSKSLGLRPVCVY 618

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT + E I +L+ G  ++V TPGR+ DM+
Sbjct: 619 GGTGISEQIAELKRGAEIIVCTPGRMIDML 648



 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 23/95 (24%), Positives = 46/95 (48%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLS 395
           C  G     +  ++ R  +   +   VLDEAD M   GF+ Q+  +   +  D Q ++ S
Sbjct: 639 CTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFS 698

Query: 396 ATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           AT P  +  ++R  ++ P+ ++V    +  + ++Q
Sbjct: 699 ATFPRQMEALARRILKKPIEVIVGGRSVVCKEVEQ 733


>AY058515-1|AAL13744.1|  680|Drosophila melanogaster LD21880p
           protein.
          Length = 680

 Score = 55.6 bits (128), Expect = 7e-08
 Identities = 32/90 (35%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + + + I    S+ +     A+I+APTREL  QI K +      L  +     
Sbjct: 15  GKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIGKDIRKFSKSLGLRPVCVY 74

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT + E I +L+ G  ++V TPGR+ DM+
Sbjct: 75  GGTGISEQIAELKRGAEIIVCTPGRMIDML 104



 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 23/95 (24%), Positives = 46/95 (48%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLS 395
           C  G     +  ++ R  +   +   VLDEAD M   GF+ Q+  +   +  D Q ++ S
Sbjct: 95  CTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFS 154

Query: 396 ATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           AT P  +  ++R  ++ P+ ++V    +  + ++Q
Sbjct: 155 ATFPRQMEALARRILKKPIEVIVGGRSVVCKEVEQ 189


>AE014298-2134|AAF48446.1| 1224|Drosophila melanogaster CG6227-PA
           protein.
          Length = 1224

 Score = 55.6 bits (128), Expect = 7e-08
 Identities = 32/90 (35%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + + + I    S+ +     A+I+APTREL  QI K +      L  +     
Sbjct: 559 GKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIGKDIRKFSKSLGLRPVCVY 618

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT + E I +L+ G  ++V TPGR+ DM+
Sbjct: 619 GGTGISEQIAELKRGAEIIVCTPGRMIDML 648



 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 23/95 (24%), Positives = 46/95 (48%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLS 395
           C  G     +  ++ R  +   +   VLDEAD M   GF+ Q+  +   +  D Q ++ S
Sbjct: 639 CTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFS 698

Query: 396 ATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           AT P  +  ++R  ++ P+ ++V    +  + ++Q
Sbjct: 699 ATFPRQMEALARRILKKPIEVIVGGRSVVCKEVEQ 733


>AY089613-1|AAL90351.1|  798|Drosophila melanogaster RE28061p
           protein.
          Length = 798

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 27/62 (43%), Positives = 36/62 (58%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELA QI +           +     GG N  E +R+L+ G H++V TPGR+ D
Sbjct: 382 LVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVATPGRLED 441

Query: 250 MI 255
           MI
Sbjct: 442 MI 443



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 4/86 (4%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL----SADVQVILLSATMPDDVLE 422
           TR  +    I+  VLDEAD ML  GF+ QI  + + L    +   Q ++ SAT P  + E
Sbjct: 444 TRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSATFPKQIQE 503

Query: 423 VSRCFMRDPVRILVQKEELTLEGIKQ 500
           ++  F+ +   + V +   T E I Q
Sbjct: 504 LASDFLSNYTFLAVGRVGSTSENITQ 529


>AE014297-778|AAF54262.1|  798|Drosophila melanogaster CG9748-PA
           protein.
          Length = 798

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 27/62 (43%), Positives = 36/62 (58%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELA QI +           +     GG N  E +R+L+ G H++V TPGR+ D
Sbjct: 382 LVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVATPGRLED 441

Query: 250 MI 255
           MI
Sbjct: 442 MI 443



 Score = 46.0 bits (104), Expect = 6e-05
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 4/86 (4%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL----SADVQVILLSATMPDDVLE 422
           TR  +    I+  VLDEAD ML  GF+ QI  + + L    +   Q ++ SAT P  + E
Sbjct: 444 TRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSATFPKQIQE 503

Query: 423 VSRCFMRDPVRILVQKEELTLEGIKQ 500
           ++  F+ + + + V +   T E I Q
Sbjct: 504 LASDFLSNYIFLAVGRVGSTSENITQ 529


>AY061400-1|AAL28948.1|  791|Drosophila melanogaster LD32732p
           protein.
          Length = 791

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LILAPTREL+ QI       G   N     C GG +  E  + LE G  ++V TPGR+ D
Sbjct: 346 LILAPTRELSLQIYNEAKKFGKVYNLNVVCCYGGGSKWEQSKALEQGAEIIVATPGRMID 405

Query: 250 MI 255
           M+
Sbjct: 406 MV 407



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 22/67 (32%), Positives = 36/67 (53%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           +A +   +   VLDEAD M   GF+ Q+  +   +  D Q ++ SAT    +  ++R  +
Sbjct: 410 KATNLRRVTFLVLDEADRMFHMGFEPQVRSICNHVRPDRQCLMFSATFKKRIERLARDVL 469

Query: 441 RDPVRIL 461
            DPVRI+
Sbjct: 470 SDPVRIV 476


>AE014296-1853|AAF50131.1|  791|Drosophila melanogaster CG6418-PB
           protein.
          Length = 791

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LILAPTREL+ QI       G   N     C GG +  E  + LE G  ++V TPGR+ D
Sbjct: 346 LILAPTRELSLQIYNEAKKFGKVYNLNVVCCYGGGSKWEQSKALEQGAEIIVATPGRMID 405

Query: 250 MI 255
           M+
Sbjct: 406 MV 407



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 22/67 (32%), Positives = 36/67 (53%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           +A +   +   VLDEAD M   GF+ Q+  +   +  D Q ++ SAT    +  ++R  +
Sbjct: 410 KATNLRRVTFLVLDEADRMFHMGFEPQVRSICNHVRPDRQCLMFSATFKKRIERLARDVL 469

Query: 441 RDPVRIL 461
            DPVRI+
Sbjct: 470 SDPVRIV 476


>Z23266-1|CAA80804.1|  527|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 527

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 28/83 (33%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL+++        AL+L PT ELA QI +  +  G  +  +     GGT+ 
Sbjct: 56  GKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQ 115

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
             + ++L    H+VV  PGR+ D
Sbjct: 116 MVESQKLMQRPHIVVAMPGRLAD 138



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVS 428
           + +K  V+DEAD ML+  F + +  + + L    Q +  SATM D + E S
Sbjct: 149 DNLKYLVVDEADPMLNGDFDESLSIIERCLPKTRQNLFFSATMKDFIKESS 199


>L13612-1|AAA16339.1|  527|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 527

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 28/83 (33%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL+++        AL+L PT ELA QI +  +  G  +  +     GGT+ 
Sbjct: 56  GKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQ 115

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
             + ++L    H+VV  PGR+ D
Sbjct: 116 MVESQKLMQRPHIVVAMPGRLAD 138



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVS 428
           + +K  V+DEAD ML+  F + +  + + L    Q +  SATM D + E S
Sbjct: 149 DNLKYLVVDEADPMLNGDFDESLSIIERCLPKTRQNLFFSATMKDFIKESS 199


>AY058728-1|AAL13957.1|  521|Drosophila melanogaster LD47509p
           protein.
          Length = 521

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 28/83 (33%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL+++        AL+L PT ELA QI +  +  G  +  +     GGT+ 
Sbjct: 56  GKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQ 115

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
             + ++L    H+VV  PGR+ D
Sbjct: 116 MVESQKLMQRPHIVVAMPGRLAD 138



 Score = 34.7 bits (76), Expect = 0.14
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVS 428
           + +K  V+DEAD ML+  F + +  + + L    Q +  SATM D + E S
Sbjct: 149 DNLKYLVVDEADRMLNGDFDESLSIIERCLPKTRQNLFFSATMKDFIKESS 199


>AE013599-778|AAF58994.1|  521|Drosophila melanogaster CG12759-PA
           protein.
          Length = 521

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 28/83 (33%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL+++        AL+L PT ELA QI +  +  G  +  +     GGT+ 
Sbjct: 56  GKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQ 115

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
             + ++L    H+VV  PGR+ D
Sbjct: 116 MVESQKLMQRPHIVVAMPGRLAD 138



 Score = 34.7 bits (76), Expect = 0.14
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVS 428
           + +K  V+DEAD ML+  F + +  + + L    Q +  SATM D + E S
Sbjct: 149 DNLKYLVVDEADRMLNGDFDESLSIIERCLPKTRQNLFFSATMKDFIKESS 199


>BT021222-1|AAX33370.1|  822|Drosophila melanogaster RH55640p
           protein.
          Length = 822

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 25/63 (39%), Positives = 38/63 (60%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A+I+APTRELAQQI++     G  L  +    +GG +  E   +L  G  +V+ TPGR+ 
Sbjct: 474 AIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVGGLSREEQGFRLRLGCEIVIATPGRLI 533

Query: 247 DMI 255
           D++
Sbjct: 534 DVL 536


>AY060822-1|AAL28370.1|  641|Drosophila melanogaster GM01081p
           protein.
          Length = 641

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 25/63 (39%), Positives = 38/63 (60%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A+I+APTRELAQQI++     G  L  +    +GG +  E   +L  G  +V+ TPGR+ 
Sbjct: 293 AIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVGGLSREEQGFRLRLGCEIVIATPGRLI 352

Query: 247 DMI 255
           D++
Sbjct: 353 DVL 355


>AE014134-2947|AAF53680.2|  822|Drosophila melanogaster CG10333-PA
           protein.
          Length = 822

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 25/63 (39%), Positives = 38/63 (60%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A+I+APTRELAQQI++     G  L  +    +GG +  E   +L  G  +V+ TPGR+ 
Sbjct: 474 AIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVGGLSREEQGFRLRLGCEIVIATPGRLI 533

Query: 247 DMI 255
           D++
Sbjct: 534 DVL 536


>U34773-1|AAC47309.1|  725|Drosophila melanogaster DEAD-box protein
           protein.
          Length = 725

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLN---AKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           QA+I+ P+RELA+Q    +     HL+    +    IGG  + E   QL  G H+VVGTP
Sbjct: 287 QAIIMEPSRELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVVGTP 346

Query: 235 GRVYDMI 255
           GR+ +MI
Sbjct: 347 GRLEEMI 353



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 16/44 (36%), Positives = 29/44 (65%), Gaps = 6/44 (13%)
 Frame = +3

Query: 291 FVLDEADEMLSRGFK---DQIHDVFKILSAD---VQVILLSATM 404
           FVLDEAD +L +G+    D++H     +++D   +Q+++ SAT+
Sbjct: 366 FVLDEADALLKQGYTELIDRLHKQIPKITSDGRRLQMVVCSATL 409


>AY119661-1|AAM50315.1|  727|Drosophila melanogaster SD05527p
           protein.
          Length = 727

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLN---AKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           QA+I+ P+RELA+Q    +     HL+    +    IGG  + E   QL  G H+VVGTP
Sbjct: 288 QAIIMEPSRELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVVGTP 347

Query: 235 GRVYDMI 255
           GR+ +MI
Sbjct: 348 GRLEEMI 354



 Score = 31.9 bits (69), Expect = 0.99
 Identities = 21/77 (27%), Positives = 44/77 (57%), Gaps = 7/77 (9%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFK---DQIHDVFKILSAD---VQVILLSATM-PDDVLEVSRCFMR 443
           + FVLDEAD +L +G+    D++H     +++D   +Q+++ SAT+   +V +++   M 
Sbjct: 365 RFFVLDEADALLKQGYTELIDRLHKQIPKITSDGRRLQMVVCSATLHAFEVKKMAERLMH 424

Query: 444 DPVRILVQKEELTLEGI 494
            P  + ++ E+   E +
Sbjct: 425 FPTWVDLKGEDAVPETV 441


>AE014296-3658|AAF51814.1|  727|Drosophila melanogaster CG9054-PA
           protein.
          Length = 727

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLN---AKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           QA+I+ P+RELA+Q    +     HL+    +    IGG  + E   QL  G H+VVGTP
Sbjct: 288 QAIIMEPSRELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVVGTP 347

Query: 235 GRVYDMI 255
           GR+ +MI
Sbjct: 348 GRLEEMI 354



 Score = 31.9 bits (69), Expect = 0.99
 Identities = 21/77 (27%), Positives = 44/77 (57%), Gaps = 7/77 (9%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFK---DQIHDVFKILSAD---VQVILLSATM-PDDVLEVSRCFMR 443
           + FVLDEAD +L +G+    D++H     +++D   +Q+++ SAT+   +V +++   M 
Sbjct: 365 RFFVLDEADALLKQGYTELIDRLHKQIPKITSDGRRLQMVVCSATLHAFEVKKMAERLMH 424

Query: 444 DPVRILVQKEELTLEGI 494
            P  + ++ E+   E +
Sbjct: 425 FPTWVDLKGEDAVPETV 441


>AY075397-1|AAL68229.1|  827|Drosophila melanogaster LD28101p
           protein.
          Length = 827

 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 2/82 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS--IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F I + +++      +  +ALIL+PTRELA Q  K +  LG  +  K    +GG 
Sbjct: 88  GKTACFLIPLFEKLQRREPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGD 147

Query: 175 NVREDIRQLESGVHVVVGTPGR 240
           ++      + +   V+V TPGR
Sbjct: 148 SMDSQFSAIHTCPDVIVATPGR 169



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 24/69 (34%), Positives = 40/69 (57%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  N+I+  V DEAD +   GF +Q+++    L +  Q ++ SAT+P  ++E +R  + D
Sbjct: 179 LKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKLLVEFARAGLND 238

Query: 447 PVRILVQKE 473
           PV I +  E
Sbjct: 239 PVLIRLDVE 247


>AY051752-1|AAK93176.1|  619|Drosophila melanogaster LD28839p
           protein.
          Length = 619

 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 6/68 (8%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNA----KCHACI--GGTNVREDIRQLESGVHVVVGT 231
           LI+ P+RELA+Q  +++     HL A    +  +C+  GG  V E +  +  GVH+VV T
Sbjct: 257 LIICPSRELAKQTHEIIQHYSKHLQACGMPEIRSCLAMGGLPVSEALDVISRGVHIVVAT 316

Query: 232 PGRVYDMI 255
           PGR+ DM+
Sbjct: 317 PGRLMDML 324



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 21/69 (30%), Positives = 35/69 (50%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L  +  +   +DEAD M+  GF++ +  +F       Q +L SATMP  +   +R  
Sbjct: 326 KKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNFARSA 385

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 386 LVKPVTINV 394


>AF212866-1|AAF19985.1|  619|Drosophila melanogaster abstrakt
           protein protein.
          Length = 619

 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 6/68 (8%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNA----KCHACI--GGTNVREDIRQLESGVHVVVGT 231
           LI+ P+RELA+Q  +++     HL A    +  +C+  GG  V E +  +  GVH+VV T
Sbjct: 257 LIICPSRELAKQTHEIIQHYSKHLQACGMPEIRSCLAMGGLPVSEALDVISRGVHIVVAT 316

Query: 232 PGRVYDMI 255
           PGR+ DM+
Sbjct: 317 PGRLMDML 324



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 21/69 (30%), Positives = 35/69 (50%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L  +  +   +DEAD M+  GF++ +  +F       Q +L SATMP  +   +R  
Sbjct: 326 KKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNFARSA 385

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 386 LVKPVTINV 394


>AF187729-1|AAF04040.1|  614|Drosophila melanogaster DEAD-box
           protein abstrakt protein.
          Length = 614

 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 6/68 (8%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNA----KCHACI--GGTNVREDIRQLESGVHVVVGT 231
           LI+ P+RELA+Q  +++     HL A    +  +C+  GG  V E +  +  GVH+VV T
Sbjct: 252 LIICPSRELAKQTHEIIQHYSKHLQACGMPEIRSCLAMGGLPVSEALDVISRGVHIVVAT 311

Query: 232 PGRVYDMI 255
           PGR+ DM+
Sbjct: 312 PGRLMDML 319



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 21/69 (30%), Positives = 35/69 (50%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L  +  +   +DEAD M+  GF++ +  +F       Q +L SATMP  +   +R  
Sbjct: 321 KKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNFARSA 380

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 381 LVKPVTINV 389


>AE014297-15|AAF52165.1|  619|Drosophila melanogaster CG14637-PA
           protein.
          Length = 619

 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 6/68 (8%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNA----KCHACI--GGTNVREDIRQLESGVHVVVGT 231
           LI+ P+RELA+Q  +++     HL A    +  +C+  GG  V E +  +  GVH+VV T
Sbjct: 257 LIICPSRELAKQTHEIIQHYSKHLQACGMPEIRSCLAMGGLPVSEALDVISRGVHIVVAT 316

Query: 232 PGRVYDMI 255
           PGR+ DM+
Sbjct: 317 PGRLMDML 324



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 21/69 (30%), Positives = 35/69 (50%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ L  +  +   +DEAD M+  GF++ +  +F       Q +L SATMP  +   +R  
Sbjct: 326 KKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNFARSA 385

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 386 LVKPVTINV 394


>AE014296-83|AAN11439.1|  827|Drosophila melanogaster CG32344-PA
           protein.
          Length = 827

 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 2/82 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS--IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F I + +++      +  +ALIL+PTRELA Q  K +  LG  +  K    +GG 
Sbjct: 88  GKTACFLIPLFEKLQRREPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGD 147

Query: 175 NVREDIRQLESGVHVVVGTPGR 240
           ++      + +   V+V TPGR
Sbjct: 148 SMDSQFSAIHTCPDVIVATPGR 169



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 24/69 (34%), Positives = 40/69 (57%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  N+I+  V DEAD +   GF +Q+++    L +  Q ++ SAT+P  ++E +R  + D
Sbjct: 179 LKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKLLVEFARAGLND 238

Query: 447 PVRILVQKE 473
           PV I +  E
Sbjct: 239 PVLIRLDVE 247


>X12945-1|CAA31405.1|  661|Drosophila melanogaster vasa protein.
          Length = 661

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F + IL ++     +  +   Q +I++PTRELA QI             K     
Sbjct: 294 GKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVY 353

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT+ R     +  G HVV+ TPGR+ D +
Sbjct: 354 GGTSFRHQNECITRGCHVVIATPGRLLDFV 383



 Score = 37.9 bits (84), Expect = 0.015
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFK--ILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           +  VLDEAD ML  GF + +  +     +  + Q ++ SAT P+++  ++  F+++ V +
Sbjct: 394 RFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVSV 453

Query: 459 LV 464
            +
Sbjct: 454 AI 455


>AY084126-1|AAL89864.1|  376|Drosophila melanogaster RE20606p
           protein.
          Length = 376

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F + IL ++     +  +   Q +I++PTRELA QI             K     
Sbjct: 9   GKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVY 68

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT+ R     +  G HVV+ TPGR+ D +
Sbjct: 69  GGTSFRHQNECITRGCHVVIATPGRLLDFV 98



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFK--ILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           +  VLDEAD ML  GF + +  +     +  + Q ++ SAT P+++  ++  F+++ V +
Sbjct: 109 RFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFV 168

Query: 459 LV 464
            +
Sbjct: 169 AI 170


>AE014134-2564|AAF53438.1|  661|Drosophila melanogaster CG3506-PA
           protein.
          Length = 661

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F + IL ++     +  +   Q +I++PTRELA QI             K     
Sbjct: 294 GKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVY 353

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT+ R     +  G HVV+ TPGR+ D +
Sbjct: 354 GGTSFRHQNECITRGCHVVIATPGRLLDFV 383



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFK--ILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           +  VLDEAD ML  GF + +  +     +  + Q ++ SAT P+++  ++  F+++ V +
Sbjct: 394 RFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFV 453

Query: 459 LV 464
            +
Sbjct: 454 AI 455


>M23560-1|AAA29013.1|  648|Drosophila melanogaster protein (
           D.melanogaster antigenMab46F11 (vasa) mRNA, complete
           cds. ).
          Length = 648

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 31/90 (34%), Positives = 43/90 (47%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F + IL ++     +  +   Q  I++PTRELA QI             K     
Sbjct: 281 GKTAAFLLPILSKLLEDPHELELGRPQVCIVSPTRELAIQIFNEARKFAFESYLKIGIVY 340

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT+ R     +  G HVV+ TPGR+ D +
Sbjct: 341 GGTSFRHQNECITRGCHVVIATPGRLLDFV 370



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFK--ILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           +  VLDEAD ML  GF + +  +     +  + Q ++ SAT P+++  ++  F+++ V +
Sbjct: 381 RFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFV 440

Query: 459 LV 464
            +
Sbjct: 441 AI 442


>AY071389-1|AAL49011.1|  288|Drosophila melanogaster RE44177p
           protein.
          Length = 288

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +++L +++  +   Q L L+PT ELA Q  +V   +G      K    + G  
Sbjct: 124 GKTAAFVLAMLSRVNVCLNHPQVLCLSPTYELAIQTGEVAARMGQFCREIKLRFAVRGEE 183

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLM 303
           V +  +++E   H+++GTPG++ D  +  R        +F++
Sbjct: 184 V-DRSKKIEE--HILIGTPGKLLDWGIKFRLFDMKKISVFVL 222



 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R      I +FVLDEAD M++ +G  DQ   + K+L+   Q++  SAT   +V++ +R  
Sbjct: 210 RLFDMKKISVFVLDEADVMIATQGHHDQCIRIHKMLNPHCQMLFFSATYGKEVMDFARLI 269

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           + DP   +++++EL L G++Q
Sbjct: 270 VADPT--IIRQKELLL-GLQQ 287


>AY051513-1|AAK92937.1|  613|Drosophila melanogaster GH16590p
           protein.
          Length = 613

 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 23/74 (31%), Positives = 41/74 (55%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   A    +++  VLDEAD +L  GFK  ++++   L    +  L SAT   +V ++ R
Sbjct: 157 DLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTGLFSATQTTEVTDLIR 216

Query: 432 CFMRDPVRILVQKE 473
             +R+PV + V+++
Sbjct: 217 AGLRNPVLVSVKEK 230



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 4/70 (5%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAK---CHACIGGTNVREDIRQLESGVH-VV 222
           +E  AL+++PTRELA+QI +V+    +H + +       +GG ++ EDI  L      ++
Sbjct: 81  KEIGALVISPTRELARQISEVLAQFLEHEDLEHLNQQLIVGGNSIEEDIATLRRETPCIL 140

Query: 223 VGTPGRVYDM 252
           V TPGR+ D+
Sbjct: 141 VCTPGRLEDL 150


>AE014297-721|AAF54208.1|  613|Drosophila melanogaster CG9630-PA
           protein.
          Length = 613

 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 23/74 (31%), Positives = 41/74 (55%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   A    +++  VLDEAD +L  GFK  ++++   L    +  L SAT   +V ++ R
Sbjct: 157 DLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTGLFSATQTTEVTDLIR 216

Query: 432 CFMRDPVRILVQKE 473
             +R+PV + V+++
Sbjct: 217 AGLRNPVLVSVKEK 230



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 4/70 (5%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAK---CHACIGGTNVREDIRQLESGVH-VV 222
           +E  AL+++PTRELA+QI +V+    +H + +       +GG ++ EDI  L      ++
Sbjct: 81  KEIGALVISPTRELARQISEVLAQFLEHEDLEHLNQQLIVGGNSIEEDIATLRRETPCIL 140

Query: 223 VGTPGRVYDM 252
           V TPGR+ D+
Sbjct: 141 VCTPGRLEDL 150


>BT004908-1|AAO49161.1|  782|Drosophila melanogaster LD15481p
           protein.
          Length = 782

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 23/88 (26%), Positives = 48/88 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           ++I++ +LDEAD ML   F +Q+ ++        Q +L SATM + V +++   +  P++
Sbjct: 303 DSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIK 362

Query: 456 ILVQKEELTLEGIKQFYMH*IRRMEAGN 539
           + V   +     ++Q ++  IR  + G+
Sbjct: 363 VFVNNNQQVAFNLRQEFIR-IREDKEGD 389



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQA----LILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA + +  L+++       +A    L+L PTREL  Q+ +V   L           IG
Sbjct: 206 GKTAAYMLPTLERLLYRPLNNKAITRVLVLVPTRELGAQVYQVTKQLCQFTTIDVGLAIG 265

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           G +V+     L     +V+ TPGR+ D I
Sbjct: 266 GLDVKAQEAVLRQNPDIVIATPGRLIDHI 294


>AF181659-1|AAD55444.1|  641|Drosophila melanogaster BcDNA.GM05306
           protein.
          Length = 641

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 23/88 (26%), Positives = 48/88 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           ++I++ +LDEAD ML   F +Q+ ++        Q +L SATM + V +++   +  P++
Sbjct: 303 DSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIK 362

Query: 456 ILVQKEELTLEGIKQFYMH*IRRMEAGN 539
           + V   +     ++Q ++  IR  + G+
Sbjct: 363 VFVNNNQQVAFNLRQEFIR-IREDKEGD 389



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQA----LILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA + +  L+++       +A    L+L PTREL  Q+ +V   L           IG
Sbjct: 206 GKTAAYMLPTLERLLYRPLNNKAITRVLVLVPTRELGAQVYQVTKQLCQFTTIDVGLAIG 265

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           G +V+     L     +V+ TPGR+ D I
Sbjct: 266 GLDVKAQEAVLRQNPDIVIATPGRLIDHI 294


>AE013599-611|AAF59119.1|  782|Drosophila melanogaster CG2173-PA
           protein.
          Length = 782

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 23/88 (26%), Positives = 48/88 (54%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           ++I++ +LDEAD ML   F +Q+ ++        Q +L SATM + V +++   +  P++
Sbjct: 303 DSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIK 362

Query: 456 ILVQKEELTLEGIKQFYMH*IRRMEAGN 539
           + V   +     ++Q ++  IR  + G+
Sbjct: 363 VFVNNNQQVAFNLRQEFIR-IREDKEGD 389



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQA----LILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKTA + +  L+++       +A    L+L PTREL  Q+ +V   L           IG
Sbjct: 206 GKTAAYMLPTLERLLYRPLNNKAITRVLVLVPTRELGAQVYQVTKQLCQFTTIDVGLAIG 265

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           G +V+     L     +V+ TPGR+ D I
Sbjct: 266 GLDVKAQEAVLRQNPDIVIATPGRLIDHI 294


>BT010296-1|AAQ23614.1|  813|Drosophila melanogaster LD11580p
           protein.
          Length = 813

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L PTRELA Q++  ++A   +   +  A  GG  V +  R L     +VV TPGR+++
Sbjct: 344 LVLTPTRELAVQVKNHLVAAAKYTGIRVAAIFGGLAVAKQERVLRQCPDIVVATPGRLWE 403

Query: 250 M 252
           +
Sbjct: 404 L 404



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 10/33 (30%), Positives = 21/33 (63%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQ 380
           +   V+DE D M+ +G  +++  + K+L++D Q
Sbjct: 418 VSFLVIDETDRMVEKGHFEELRSLLKVLNSDEQ 450


>AE013599-2990|AAF57487.1|  813|Drosophila melanogaster CG9143-PA
           protein.
          Length = 813

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L PTRELA Q++  ++A   +   +  A  GG  V +  R L     +VV TPGR+++
Sbjct: 344 LVLTPTRELAVQVKNHLVAAAKYTGIRVAAIFGGLAVAKQERVLRQCPDIVVATPGRLWE 403

Query: 250 M 252
           +
Sbjct: 404 L 404



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 10/33 (30%), Positives = 21/33 (63%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQ 380
           +   V+DE D M+ +G  +++  + K+L++D Q
Sbjct: 418 VSFLVIDETDRMVEKGHFEELRSLLKVLNSDEQ 450


>AY119628-1|AAM50282.1|  826|Drosophila melanogaster RE19835p
           protein.
          Length = 826

 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 21/69 (30%), Positives = 39/69 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D     + +T+++ VLDEAD  L  GF+  ++ + +      Q +L SAT  + V +++R
Sbjct: 209 DENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLAR 268

Query: 432 CFMRDPVRI 458
             ++DPV +
Sbjct: 269 LNLKDPVYV 277



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 4/85 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F I +L+ +  +         A+I++PTRELA QI + +  +G H +      IG
Sbjct: 121 GKTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIG 180

Query: 169 GTNVREDIRQLESGVHVVVGTPGRV 243
           G N++ +  +++   ++++ TPGR+
Sbjct: 181 GKNLKFERTRMDQ-CNILICTPGRL 204


>AE014298-2591|AAF48747.2|  826|Drosophila melanogaster CG5800-PA
           protein.
          Length = 826

 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 21/69 (30%), Positives = 39/69 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D     + +T+++ VLDEAD  L  GF+  ++ + +      Q +L SAT  + V +++R
Sbjct: 209 DENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLAR 268

Query: 432 CFMRDPVRI 458
             ++DPV +
Sbjct: 269 LNLKDPVYV 277



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 4/85 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F I +L+ +  +         A+I++PTRELA QI + +  +G H +      IG
Sbjct: 121 GKTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIG 180

Query: 169 GTNVREDIRQLESGVHVVVGTPGRV 243
           G N++ +  +++   ++++ TPGR+
Sbjct: 181 GKNLKFERTRMDQ-CNILICTPGRL 204


>AF145609-1|AAD38584.1|  974|Drosophila melanogaster BcDNA.GH02833
           protein.
          Length = 974

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 29/108 (26%), Positives = 55/108 (50%), Gaps = 8/108 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELAQQIQKVVIAL-GDHLNAKCHA 159
           GKT  +++ +++ +       Q      AL++ PTREL  Q  +++  L   +      +
Sbjct: 376 GKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPTRELVMQTYELIQKLVKPYTWIVPGS 435

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMIL-VVRFMPTPSNFLFL 300
            +GG + + +  +L  G+++++GTPGR+ D +L    F  T   FL L
Sbjct: 436 LLGGESRKSEKARLRKGINILIGTPGRLVDHLLHTASFKLTKLQFLIL 483


>AE014298-2568|AAO41693.1|  975|Drosophila melanogaster CG8611-PB,
           isoform B protein.
          Length = 975

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 29/108 (26%), Positives = 55/108 (50%), Gaps = 8/108 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELAQQIQKVVIAL-GDHLNAKCHA 159
           GKT  +++ +++ +       Q      AL++ PTREL  Q  +++  L   +      +
Sbjct: 377 GKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPTRELVMQTYELIQKLVKPYTWIVPGS 436

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMIL-VVRFMPTPSNFLFL 300
            +GG + + +  +L  G+++++GTPGR+ D +L    F  T   FL L
Sbjct: 437 LLGGESRKSEKARLRKGINILIGTPGRLVDHLLHTASFKLTKLQFLIL 484


>AE014298-2567|AAF48727.2|  974|Drosophila melanogaster CG8611-PA,
           isoform A protein.
          Length = 974

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 29/108 (26%), Positives = 55/108 (50%), Gaps = 8/108 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELAQQIQKVVIAL-GDHLNAKCHA 159
           GKT  +++ +++ +       Q      AL++ PTREL  Q  +++  L   +      +
Sbjct: 376 GKTLAYALPLVELLQKQQPRIQRKDGVLALVIVPTRELVMQTYELIQKLVKPYTWIVPGS 435

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMIL-VVRFMPTPSNFLFL 300
            +GG + + +  +L  G+++++GTPGR+ D +L    F  T   FL L
Sbjct: 436 LLGGESRKSEKARLRKGINILIGTPGRLVDHLLHTASFKLTKLQFLIL 483


>U84552-1|AAC27683.1|  663|Drosophila melanogaster helicase
           pitchoune protein.
          Length = 663

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/60 (35%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +I++PTREL+ Q   V+  L  H +      +GG+N + +  +L  G++++V TPGR+ D
Sbjct: 246 IIISPTRELSMQTFGVLKELMAHHHHTYGLVMGGSNRQVESEKLGKGINILVATPGRLLD 305



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 19/79 (24%), Positives = 46/79 (58%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR-DPVRI 458
           ++  ++DE D +L  GF++++  +  +L    Q +L SAT    +  +S+  ++ +P+ +
Sbjct: 318 LQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTARIEALSKLALKSEPIYV 377

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   ++  T++G++Q Y+
Sbjct: 378 GVHDNQDTATVDGLEQGYI 396


>AY119620-1|AAM50274.1|  680|Drosophila melanogaster LD46167p
           protein.
          Length = 680

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/60 (35%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +I++PTREL+ Q   V+  L  H +      +GG+N + +  +L  G++++V TPGR+ D
Sbjct: 263 IIISPTRELSMQTFGVLKELMAHHHHTYGLVMGGSNRQVESEKLGKGINILVATPGRLLD 322



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 19/79 (24%), Positives = 46/79 (58%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR-DPVRI 458
           ++  ++DE D +L  GF++++  +  +L    Q +L SAT    +  +S+  ++ +P+ +
Sbjct: 335 LQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTARIEALSKLALKSEPIYV 394

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   ++  T++G++Q Y+
Sbjct: 395 GVHDNQDTATVDGLEQGYI 413


>AY071402-1|AAL49024.1|  680|Drosophila melanogaster RE48840p
           protein.
          Length = 680

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/60 (35%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +I++PTREL+ Q   V+  L  H +      +GG+N + +  +L  G++++V TPGR+ D
Sbjct: 263 IIISPTRELSMQTFGVLKELMAHHHHTYGLVMGGSNRQVESEKLGKGINILVATPGRLLD 322



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 19/79 (24%), Positives = 46/79 (58%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR-DPVRI 458
           ++  ++DE D +L  GF++++  +  +L    Q +L SAT    +  +S+  ++ +P+ +
Sbjct: 335 LQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTARIEALSKLALKSEPIYV 394

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   ++  T++G++Q Y+
Sbjct: 395 GVHDNQDTATVDGLEQGYI 413


>AY070624-1|AAL48095.1|  560|Drosophila melanogaster RE72861p
           protein.
          Length = 560

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/66 (30%), Positives = 39/66 (59%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           ++  V+DEAD + + G++     + K L    Q +L+SAT+ DDV+ +    + +PV + 
Sbjct: 161 VETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATLTDDVVRMKGLCLNNPVTLK 220

Query: 462 VQKEEL 479
           +++ EL
Sbjct: 221 LEEPEL 226



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 8/89 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTAT+++ ++Q+I     + S +   A++LAPT+EL +Q +KV+  L +          
Sbjct: 58  GKTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVIEQLVESCGKVVRVAD 117

Query: 166 GGTNVREDIRQ---LESGVHVVVGTPGRV 243
              +  + + Q   L     +VV TP  +
Sbjct: 118 IADSSNDTVTQRHALSESPDIVVATPANL 146


>AF017777-10|AAC28406.1|  560|Drosophila melanogaster helicase
           protein.
          Length = 560

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/66 (30%), Positives = 39/66 (59%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           ++  V+DEAD + + G++     + K L    Q +L+SAT+ DDV+ +    + +PV + 
Sbjct: 161 VETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATLTDDVVRMKGLCLNNPVTLK 220

Query: 462 VQKEEL 479
           +++ EL
Sbjct: 221 LEEPEL 226



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 8/89 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTAT+++ ++Q+I     + S +   A++LAPT+EL +Q +KV+  L +          
Sbjct: 58  GKTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVIEQLVESCGKVVRVAD 117

Query: 166 GGTNVREDIRQ---LESGVHVVVGTPGRV 243
              +  + + Q   L     +VV TP  +
Sbjct: 118 IADSSNDTVTQRHALSESPDIVVATPANL 146


>AE014298-3138|AAF50818.2|  560|Drosophila melanogaster CG1666-PA
           protein.
          Length = 560

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/66 (30%), Positives = 39/66 (59%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           ++  V+DEAD + + G++     + K L    Q +L+SAT+ DDV+ +    + +PV + 
Sbjct: 161 VETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATLTDDVVRMKGLCLNNPVTLK 220

Query: 462 VQKEEL 479
           +++ EL
Sbjct: 221 LEEPEL 226



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 8/89 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTAT+++ ++Q+I     + S +   A++LAPT+EL +Q +KV+  L +          
Sbjct: 58  GKTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVIEQLVESCGKVVRVAD 117

Query: 166 GGTNVREDIRQ---LESGVHVVVGTPGRV 243
              +  + + Q   L     +VV TP  +
Sbjct: 118 IADSSNDTVTQRHALSESPDIVVATPANL 146


>AE014297-3091|AAN13900.2|  680|Drosophila melanogaster CG6375-PB,
           isoform B protein.
          Length = 680

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/60 (35%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +I++PTREL+ Q   V+  L  H +      +GG+N + +  +L  G++++V TPGR+ D
Sbjct: 263 IIISPTRELSMQTFGVLKELMAHHHHTYGLVMGGSNRQVESEKLGKGINILVATPGRLLD 322



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 19/79 (24%), Positives = 46/79 (58%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR-DPVRI 458
           ++  ++DE D +L  GF++++  +  +L    Q +L SAT    +  +S+  ++ +P+ +
Sbjct: 335 LQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTARIEALSKLALKSEPIYV 394

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   ++  T++G++Q Y+
Sbjct: 395 GVHDNQDTATVDGLEQGYI 413


>AE014297-3090|AAF55951.2|  680|Drosophila melanogaster CG6375-PA,
           isoform A protein.
          Length = 680

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/60 (35%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +I++PTREL+ Q   V+  L  H +      +GG+N + +  +L  G++++V TPGR+ D
Sbjct: 263 IIISPTRELSMQTFGVLKELMAHHHHTYGLVMGGSNRQVESEKLGKGINILVATPGRLLD 322



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 19/79 (24%), Positives = 46/79 (58%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR-DPVRI 458
           ++  ++DE D +L  GF++++  +  +L    Q +L SAT    +  +S+  ++ +P+ +
Sbjct: 335 LQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTARIEALSKLALKSEPIYV 394

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   ++  T++G++Q Y+
Sbjct: 395 GVHDNQDTATVDGLEQGYI 413


>AY113641-1|AAM29646.1|  388|Drosophila melanogaster RH74035p
           protein.
          Length = 388

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 20/66 (30%), Positives = 38/66 (57%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           ++  V+DEAD + + G++     + K L    Q +L+SAT+ DDV  +    + +PV + 
Sbjct: 161 VETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATLTDDVARMKGLCLNNPVTLK 220

Query: 462 VQKEEL 479
           +++ EL
Sbjct: 221 LEEPEL 226



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 8/89 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTAT+++ ++Q+I     + S +   A++LAPT+EL +Q +KV+  L +          
Sbjct: 58  GKTATYALPLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVIEQLVESCGKVVRVAD 117

Query: 166 GGTNVREDIRQ---LESGVHVVVGTPGRV 243
              +  + + Q   L     +VV TP  +
Sbjct: 118 IADSSNDTVTQRHALSESPDIVVATPANL 146


>AE014296-2963|AAF49303.1|  594|Drosophila melanogaster CG5589-PA
           protein.
          Length = 594

 Score = 37.1 bits (82), Expect = 0.026
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 4/82 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG---FKDQIHDVFKILSADVQ-VILLSATMPDDVLEVSRC 434
           L  + ++ FVLDEAD ++  G   FK+Q+ D++   S   + V   SAT    V + +  
Sbjct: 261 LDLSHVEWFVLDEADRLMEEGQNNFKEQLDDIYAACSNPTKCVAFFSATYTVPVAKWALR 320

Query: 435 FMRDPVRILVQKEELTLEGIKQ 500
            +++ VRI +  +    E ++Q
Sbjct: 321 HLKNLVRITIGVQNSATETVQQ 342



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT-SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKT  F   I+  +        +AL+LAPTRELAQQI +    L      + H     + 
Sbjct: 168 GKTLAFLTPIINGLRAHKTTGLRALVLAPTRELAQQIYRECAELTRETGLRTHFISKVSE 227

Query: 178 VREDI-RQLESGVHVVVGTPGRV 243
            ++    + +    ++V TP RV
Sbjct: 228 AKQKHGAECKQRYDILVSTPNRV 250


>AY069298-1|AAL39443.1|  157|Drosophila melanogaster HL01868p
           protein.
          Length = 157

 Score = 35.5 bits (78), Expect = 0.080
 Identities = 15/48 (31%), Positives = 30/48 (62%)
 Frame = +3

Query: 315 MLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           ML  GF+ QI  + + +  D QV++ SAT P +V +++  F+ + +++
Sbjct: 1   MLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQV 48


>AE014296-1164|AAN12065.1|  157|Drosophila melanogaster CG10077-PB,
           isoform B protein.
          Length = 157

 Score = 35.5 bits (78), Expect = 0.080
 Identities = 15/48 (31%), Positives = 30/48 (62%)
 Frame = +3

Query: 315 MLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           ML  GF+ QI  + + +  D QV++ SAT P +V +++  F+ + +++
Sbjct: 1   MLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQV 48


>AY058512-1|AAL13741.1|  536|Drosophila melanogaster LD21669p
           protein.
          Length = 536

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT T+ + I+ ++       +  +   + LIL P RELA QI  V   L    N K  +
Sbjct: 158 GKTITYLLPIVDKLLQKEVVTERKLNTPRVLILTPGRELATQIAGVTEKLTQGTNLKVQS 217

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   +  +      V ++V T G +  ++
Sbjct: 218 LLGGNTKQLMMNPQFEEVDILVATLGALSKLV 249



 Score = 29.1 bits (62), Expect = 7.0
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 9/57 (15%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQI---------HDVFKILSADVQVILLSATMPDDVLEV 425
           ++  VLDEAD +L   F D++         H V K   A  Q+IL SATMP +  E+
Sbjct: 259 VRHLVLDEADTLLDDTFTDKLSYFLRRFPFHLVQK-EDAGTQMILASATMPTNTREI 314


>AE014134-152|AAF51458.1|  536|Drosophila melanogaster CG3561-PA
           protein.
          Length = 536

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT T+ + I+ ++       +  +   + LIL P RELA QI  V   L    N K  +
Sbjct: 158 GKTITYLLPIVDKLLQKEVVTERKLNTPRVLILTPGRELATQIAGVTEKLTQGTNLKVQS 217

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   +  +      V ++V T G +  ++
Sbjct: 218 LLGGNTKQLMMNPQFEEVDILVATLGALSKLV 249



 Score = 29.1 bits (62), Expect = 7.0
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 9/57 (15%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQI---------HDVFKILSADVQVILLSATMPDDVLEV 425
           ++  VLDEAD +L   F D++         H V K   A  Q+IL SATMP +  E+
Sbjct: 259 VRHLVLDEADTLLDDTFTDKLSYFLRRFPFHLVQK-EDAGTQMILASATMPTNTREI 314


>BT023900-1|ABA81834.1| 1576|Drosophila melanogaster LP13775p
           protein.
          Length = 1576

 Score = 33.5 bits (73), Expect = 0.32
 Identities = 23/83 (27%), Positives = 35/83 (42%)
 Frame = -3

Query: 424 TSNTSSGMVAESNMT*TSADKILKTSWIWSLKPLDNISSASSRTKSLMVLA*SARRVSYH 245
           +SN +S   A +N    S++    T  +  L  + +IS AS  T     ++ S       
Sbjct: 219 SSNNNSNGSATNNNNNNSSESTSSTETLKWLGSMSDISEASHAT-GYSAISESVSSSQRI 277

Query: 244 IHDLECPPPHEHHSPVGEYLHGH 176
           +H    P P  HHS    YLH +
Sbjct: 278 VHSSRVPTPKRHHSESVLYLHNN 300


>AE013599-1871|AAF58260.1|  856|Drosophila melanogaster CG13942-PA
           protein.
          Length = 856

 Score = 33.5 bits (73), Expect = 0.32
 Identities = 23/83 (27%), Positives = 35/83 (42%)
 Frame = -3

Query: 424 TSNTSSGMVAESNMT*TSADKILKTSWIWSLKPLDNISSASSRTKSLMVLA*SARRVSYH 245
           +SN +S   A +N    S++    T  +  L  + +IS AS  T     ++ S       
Sbjct: 157 SSNNNSNGSATNNNNNNSSESTSSTETLKWLGSMSDISEASHAT-GYSAISESVSSSQRI 215

Query: 244 IHDLECPPPHEHHSPVGEYLHGH 176
           +H    P P  HHS    YLH +
Sbjct: 216 VHSSRVPTPKRHHSESVLYLHNN 238


>AY118543-1|AAM49912.1|  705|Drosophila melanogaster LD28410p
           protein.
          Length = 705

 Score = 32.3 bits (70), Expect = 0.75
 Identities = 29/116 (25%), Positives = 44/116 (37%), Gaps = 1/116 (0%)
 Frame = -3

Query: 448 GSLIKHRDTSNTSSGMVAESNMT*TSADKILKTSWIWSLKPLDNISSASSRTKSLMVLA* 269
           G+   H D  ++S G  A  N T  S   +  +     L P       S  T S+ +   
Sbjct: 569 GAATGHLDGHSSSRGSHAACNSTVVSYHSVRTSMASVPLPPSPYKLKTSPGTGSISLNQM 628

Query: 268 SARRVSYHIHDLECPPPHEHHSPVGEYLHGHWCHQCKHGI*HS-SDHQELSPPSEF 104
           S   +   +H  +   PH HH    ++   H  H  +H   HS S H+   PP  +
Sbjct: 629 SNYSLGRSVHHQQRHSPHHHHHQQQQHHQFHPHHNHQH---HSTSSHRLYYPPGSY 681


>AF241270-1|AAF81195.1|  705|Drosophila melanogaster frizzled 4
           protein.
          Length = 705

 Score = 32.3 bits (70), Expect = 0.75
 Identities = 29/116 (25%), Positives = 44/116 (37%), Gaps = 1/116 (0%)
 Frame = -3

Query: 448 GSLIKHRDTSNTSSGMVAESNMT*TSADKILKTSWIWSLKPLDNISSASSRTKSLMVLA* 269
           G+   H D  ++S G  A  N T  S   +  +     L P       S  T S+ +   
Sbjct: 569 GAATGHLDGHSSSRGSHAACNSTVVSYHSVRTSMASVPLPPSPYKLKTSPGTGSISLNQM 628

Query: 268 SARRVSYHIHDLECPPPHEHHSPVGEYLHGHWCHQCKHGI*HS-SDHQELSPPSEF 104
           S   +   +H  +   PH HH    ++   H  H  +H   HS S H+   PP  +
Sbjct: 629 SNYSLGRSVHHQQRHSPHHHHHQQQQHHQFHPHHNHQH---HSTSSHRLYYPPGSY 681


>AE014298-1020|AAF46245.2|  705|Drosophila melanogaster CG4626-PB,
           isoform B protein.
          Length = 705

 Score = 32.3 bits (70), Expect = 0.75
 Identities = 29/116 (25%), Positives = 44/116 (37%), Gaps = 1/116 (0%)
 Frame = -3

Query: 448 GSLIKHRDTSNTSSGMVAESNMT*TSADKILKTSWIWSLKPLDNISSASSRTKSLMVLA* 269
           G+   H D  ++S G  A  N T  S   +  +     L P       S  T S+ +   
Sbjct: 569 GAATGHLDGHSSSRGSHAACNSTVVSYHSVRTSMASVPLPPSPYKLKTSPGTGSISLNQM 628

Query: 268 SARRVSYHIHDLECPPPHEHHSPVGEYLHGHWCHQCKHGI*HS-SDHQELSPPSEF 104
           S   +   +H  +   PH HH    ++   H  H  +H   HS S H+   PP  +
Sbjct: 629 SNYSLGRSVHHQQRHSPHHHHHQQQQHHQFHPHHNHQH---HSTSSHRLYYPPGSY 681


>AE014298-1019|AAN09202.1|  705|Drosophila melanogaster CG4626-PA,
           isoform A protein.
          Length = 705

 Score = 32.3 bits (70), Expect = 0.75
 Identities = 29/116 (25%), Positives = 44/116 (37%), Gaps = 1/116 (0%)
 Frame = -3

Query: 448 GSLIKHRDTSNTSSGMVAESNMT*TSADKILKTSWIWSLKPLDNISSASSRTKSLMVLA* 269
           G+   H D  ++S G  A  N T  S   +  +     L P       S  T S+ +   
Sbjct: 569 GAATGHLDGHSSSRGSHAACNSTVVSYHSVRTSMASVPLPPSPYKLKTSPGTGSISLNQM 628

Query: 268 SARRVSYHIHDLECPPPHEHHSPVGEYLHGHWCHQCKHGI*HS-SDHQELSPPSEF 104
           S   +   +H  +   PH HH    ++   H  H  +H   HS S H+   PP  +
Sbjct: 629 SNYSLGRSVHHQQRHSPHHHHHQQQQHHQFHPHHNHQH---HSTSSHRLYYPPGSY 681


>AE014297-2422|AAF55479.3| 2938|Drosophila melanogaster CG33547-PA
            protein.
          Length = 2938

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 11/25 (44%), Positives = 13/25 (52%)
 Frame = -3

Query: 250  YHIHDLECPPPHEHHSPVGEYLHGH 176
            YH H    P PH+H  P   +L GH
Sbjct: 1164 YHPHQHPLPHPHQHQGPPAAHLQGH 1188


>AY069247-1|AAL39392.1|  300|Drosophila melanogaster GM02310p
           protein.
          Length = 300

 Score = 30.7 bits (66), Expect = 2.3
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 8/66 (12%)
 Frame = -2

Query: 479 KLFLLYKYAYRISHKASRYFQYIIRHGSRE*YDLNIS*QNLEDIM--------DLVLETS 324
           KLFL   +AY    + ++  + I+RHGS++    +IS + LE+ +        DLV  TS
Sbjct: 148 KLFLNVAFAYTSRDEITQAVETILRHGSQDLAGEDISERLLEECLYTRHSPPPDLVFRTS 207

Query: 323 GQHFIS 306
           G+  +S
Sbjct: 208 GETRLS 213


>AE014298-1088|AAF46296.2|  300|Drosophila melanogaster CG10778-PA
           protein.
          Length = 300

 Score = 30.7 bits (66), Expect = 2.3
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 8/66 (12%)
 Frame = -2

Query: 479 KLFLLYKYAYRISHKASRYFQYIIRHGSRE*YDLNIS*QNLEDIM--------DLVLETS 324
           KLFL   +AY    + ++  + I+RHGS++    +IS + LE+ +        DLV  TS
Sbjct: 148 KLFLNVAFAYTSRDEITQAVETILRHGSQDLAGEDISERLLEECLYTRHSPPPDLVFRTS 207

Query: 323 GQHFIS 306
           G+  +S
Sbjct: 208 GETRLS 213


>X62420-1|CAA44286.1| 2515|Drosophila melanogaster tudor protein
           protein.
          Length = 2515

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +1

Query: 151 CHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNF 291
           CH    GTN+ E +RQL++             D  + +RF+ +PSNF
Sbjct: 564 CHLNQNGTNMLELLRQLKNSRQSYKKAEQLENDDAVEIRFIDSPSNF 610


>AE013599-3155|AAF46693.1| 2515|Drosophila melanogaster CG9450-PA
           protein.
          Length = 2515

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +1

Query: 151 CHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNF 291
           CH    GTN+ E +RQL++             D  + +RF+ +PSNF
Sbjct: 564 CHLNQNGTNMLELLRQLKNSRQSYKKAEQLENDDAVEIRFIDSPSNF 610


>AE014296-2526|ABC66138.1|  277|Drosophila melanogaster CG33985-PA
           protein.
          Length = 277

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = -3

Query: 454 RTGSLIKHRDTSNTSSGMV-AESNMT*TSADKILKTSWIWSLKPLDNISSASSRT 293
           RTGS ++  +T+++SS  + +ES+   T     L  S + +L+P  N S ASS T
Sbjct: 81  RTGSEVQRENTTDSSSTEITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTT 135


>AE014134-231|AAF51393.1|   80|Drosophila melanogaster CG5011-PA
           protein.
          Length = 80

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 16/38 (42%), Positives = 17/38 (44%)
 Frame = -3

Query: 226 PPPHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSPP 113
           PPPH HH+P     HG   H   H   H   H E  PP
Sbjct: 4   PPPHHHHNPPP---HGPPPHGPPH---HGPPHHEPQPP 35


>BT021344-1|AAX33492.1|  431|Drosophila melanogaster LP21640p
           protein.
          Length = 431

 Score = 29.1 bits (62), Expect = 7.0
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = -1

Query: 276 WHEAHDEYHIIYTTWSAHHHMNTTLQLANIFTDIGATN 163
           WHEA DE H++ +   A   + T +Q  N+  ++  +N
Sbjct: 63  WHEAKDELHLMLSP-GAFGELETEIQKTNVTAELFISN 99


>AE014298-1416|AAF46559.1| 1161|Drosophila melanogaster CG15311-PA
           protein.
          Length = 1161

 Score = 29.1 bits (62), Expect = 7.0
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = -3

Query: 217 HEHHSPVGEYLHGHWCHQCKHGI*HSSDH 131
           H HH   G++L  H  H   HG  H+  H
Sbjct: 713 HHHHHHSGQHLGNHHHHSHHHGYNHNGAH 741


>AE014134-1311|AAF52538.2|  429|Drosophila melanogaster CG7025-PA
           protein.
          Length = 429

 Score = 29.1 bits (62), Expect = 7.0
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = -1

Query: 276 WHEAHDEYHIIYTTWSAHHHMNTTLQLANIFTDIGATN 163
           WHEA DE H++ +   A   + T +Q  N+  ++  +N
Sbjct: 61  WHEAKDELHLMLSP-GAFGELETEIQKTNVTAELFISN 97


>BT021287-1|AAX33435.1|  826|Drosophila melanogaster RE31991p
           protein.
          Length = 826

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 13/29 (44%), Positives = 15/29 (51%)
 Frame = -3

Query: 223 PPHEHHSPVGEYLHGHWCHQCKHGI*HSS 137
           PP EHH     ++H H  H   HG  HSS
Sbjct: 750 PPSEHHHGSSSHVHNHHGHGHGHG--HSS 776


>AY118641-1|AAM50010.1|  678|Drosophila melanogaster SD02507p
           protein.
          Length = 678

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 13/29 (44%), Positives = 15/29 (51%)
 Frame = -3

Query: 223 PPHEHHSPVGEYLHGHWCHQCKHGI*HSS 137
           PP EHH     ++H H  H   HG  HSS
Sbjct: 602 PPSEHHHGSSSHVHNHHGHGHGHG--HSS 628


>AY118351-1|AAM48380.1|  182|Drosophila melanogaster LP11479p
           protein.
          Length = 182

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 10/28 (35%), Positives = 12/28 (42%)
 Frame = -3

Query: 250 YHIHDLECPPPHEHHSPVGEYLHGHWCH 167
           +H H    P    HHS    + HGH  H
Sbjct: 117 HHYHHANSPHSQSHHSHAHTHTHGHHVH 144


>AE014297-3885|AAF56538.1|  613|Drosophila melanogaster CG14540-PA
           protein.
          Length = 613

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/36 (33%), Positives = 17/36 (47%)
 Frame = -3

Query: 235 LECPPPHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQ 128
           ++ PP H+ H       H H  HQ +  + HS  HQ
Sbjct: 223 MQHPPQHQLHQQQQMTTHNHLKHQQQQRLQHSQPHQ 258


>AE014296-876|AAF47919.1|   92|Drosophila melanogaster CG13719-PA
           protein.
          Length = 92

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 2/41 (4%)
 Frame = -1

Query: 273 HEAHDEYHIIYTTWSAHH--HMNTTLQLANIFTDIGATNAS 157
           H  H+++H     W+ HH  H+N T +     T +G+ ++S
Sbjct: 18  HSQHNQHHQHQNQWALHHQNHLNQTPRSTGRQTMLGSNHSS 58


>AE014296-161|AAF47434.1|  841|Drosophila melanogaster CG13908-PA
           protein.
          Length = 841

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 10/28 (35%), Positives = 12/28 (42%)
 Frame = -3

Query: 250 YHIHDLECPPPHEHHSPVGEYLHGHWCH 167
           +H H    P    HHS    + HGH  H
Sbjct: 776 HHYHHANSPHSQSHHSHAHTHTHGHHVH 803


>AE014134-2952|AAF53685.2|  826|Drosophila melanogaster CG31790-PA
           protein.
          Length = 826

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 13/29 (44%), Positives = 15/29 (51%)
 Frame = -3

Query: 223 PPHEHHSPVGEYLHGHWCHQCKHGI*HSS 137
           PP EHH     ++H H  H   HG  HSS
Sbjct: 750 PPSEHHHGSSSHVHNHHGHGHGHG--HSS 776


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,606,003
Number of Sequences: 53049
Number of extensions: 920923
Number of successful extensions: 3808
Number of sequences better than 10.0: 117
Number of HSP's better than 10.0 without gapping: 2438
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3255
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3520086471
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).