SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30026
         (796 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-941|AAN09181.1|  632|Drosophila melanogaster CG3168-PC,...    52   7e-07
AE014298-940|AAN09180.1|  632|Drosophila melanogaster CG3168-PB,...    52   7e-07
AE014298-939|AAF46193.2|  632|Drosophila melanogaster CG3168-PA,...    52   7e-07
AL109630-12|CAB65877.1|  558|Drosophila melanogaster EG:BACR7A4....    51   2e-06
AE014298-135|AAF45574.3|  558|Drosophila melanogaster CG3690-PA ...    51   2e-06
AY070961-1|AAL48583.1|  563|Drosophila melanogaster RE06169p pro...    49   6e-06
AE014297-1184|AAF54546.3|  563|Drosophila melanogaster CG31272-P...    49   6e-06
AY113212-1|AAM29217.1|  510|Drosophila melanogaster AT07117p pro...    46   8e-05
AE014297-1183|AAO41541.1|  510|Drosophila melanogaster CG14691-P...    46   8e-05
AE014297-1182|AAF54545.2|  522|Drosophila melanogaster CG14691-P...    46   8e-05
BT024204-1|ABC86266.1|  513|Drosophila melanogaster RE45749p pro...    40   0.003
AE014297-3738|AAN14042.1|  515|Drosophila melanogaster CG31106-P...    40   0.003
AY071447-1|AAL49069.1|  478|Drosophila melanogaster RE53026p pro...    40   0.005
AE013599-3770|AAF47135.2|  478|Drosophila melanogaster CG4324-PA...    40   0.005
AE014297-3739|AAF56418.2|  360|Drosophila melanogaster CG31103-P...    38   0.016
BT001333-1|AAN71088.1|  471|Drosophila melanogaster AT19445p pro...    38   0.021
AE014297-2239|AAF55340.1|  460|Drosophila melanogaster CG12783-P...    38   0.021
BT029691-1|ABL75748.1|  247|Drosophila melanogaster IP17413p pro...    33   0.45 
BT029666-1|ABL75723.1|  247|Drosophila melanogaster IP17313p pro...    33   0.45 
AE014296-503|AAS64950.1|  342|Drosophila melanogaster CG33234-PA...    33   0.45 
AY113278-1|AAM29283.1|  151|Drosophila melanogaster AT17820p pro...    32   0.79 
AE014296-502|AAN11521.1|  151|Drosophila melanogaster CG33233-PB...    32   0.79 
BT003805-1|AAO41488.1|  489|Drosophila melanogaster AT15560p pro...    32   1.0  
AE014296-501|AAS64949.1|  488|Drosophila melanogaster CG33233-PA...    32   1.0  
AE014298-1677|AAF48086.1|  529|Drosophila melanogaster CG15221-P...    31   1.4  
AY089580-1|AAL90318.1|  667|Drosophila melanogaster RE11206p pro...    29   7.3  
AE014297-3169|AAF56010.1|  126|Drosophila melanogaster CG7045-PA...    29   9.7  

>AE014298-941|AAN09181.1|  632|Drosophila melanogaster CG3168-PC,
           isoform C protein.
          Length = 632

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 21/47 (44%), Positives = 29/47 (61%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           MS++LP+A C+L L T   G +N     G +  A+FWG + D FGRK
Sbjct: 171 MSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRK 217



 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           +  WR+FL   SLP F+    + YLPES
Sbjct: 313 YNSWRIFLLVCSLPSFLVGFLLFYLPES 340


>AE014298-940|AAN09180.1|  632|Drosophila melanogaster CG3168-PB,
           isoform B protein.
          Length = 632

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 21/47 (44%), Positives = 29/47 (61%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           MS++LP+A C+L L T   G +N     G +  A+FWG + D FGRK
Sbjct: 171 MSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRK 217



 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           +  WR+FL   SLP F+    + YLPES
Sbjct: 313 YNSWRIFLLVCSLPSFLVGFLLFYLPES 340


>AE014298-939|AAF46193.2|  632|Drosophila melanogaster CG3168-PA,
           isoform A protein.
          Length = 632

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 21/47 (44%), Positives = 29/47 (61%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           MS++LP+A C+L L T   G +N     G +  A+FWG + D FGRK
Sbjct: 171 MSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRK 217



 Score = 29.5 bits (63), Expect = 5.5
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           +  WR+FL   SLP F+    + YLPES
Sbjct: 313 YNSWRIFLLVCSLPSFLVGFLLFYLPES 340


>AL109630-12|CAB65877.1|  558|Drosophila melanogaster EG:BACR7A4.13
           protein.
          Length = 558

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 19/48 (39%), Positives = 33/48 (68%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           MSY+LP+A C+L+L+    G++N    +G ++SA  WG + D+ GR++
Sbjct: 66  MSYILPSAECDLKLSLLDKGILNAITYAGMISSAVLWGYLADIKGRRN 113



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 20/65 (30%), Positives = 34/65 (52%)
 Frame = +1

Query: 484 RSRLQTSAAARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXX 663
           +SR+Q     + + GF + GP  ++ TYL++L G K RQ  + MVG+ F           
Sbjct: 133 QSRIQLMVF-KYLGGFCMSGPFAVLMTYLTELHGRKHRQRIMMMVGIMFSIATLTLPGLA 191

Query: 664 XMVIP 678
            +++P
Sbjct: 192 MLILP 196


>AE014298-135|AAF45574.3|  558|Drosophila melanogaster CG3690-PA
           protein.
          Length = 558

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 19/48 (39%), Positives = 33/48 (68%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKS 430
           MSY+LP+A C+L+L+    G++N    +G ++SA  WG + D+ GR++
Sbjct: 66  MSYILPSAECDLKLSLLDKGILNAITYAGMISSAVLWGYLADIKGRRN 113



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 20/65 (30%), Positives = 34/65 (52%)
 Frame = +1

Query: 484 RSRLQTSAAARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXX 663
           +SR+Q     + + GF + GP  ++ TYL++L G K RQ  + MVG+ F           
Sbjct: 133 QSRIQLMVF-KYLGGFCMSGPFAVLMTYLTELHGRKHRQRIMMMVGIMFSIATLTLPGLA 191

Query: 664 XMVIP 678
            +++P
Sbjct: 192 MLILP 196


>AY070961-1|AAL48583.1|  563|Drosophila melanogaster RE06169p
           protein.
          Length = 563

 Score = 49.2 bits (112), Expect = 6e-06
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +2

Query: 245 VRVPFFASGV-QNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFG 421
           V +P  ++ + ++  MSY+LP A C+L+LT    G++N    +G   SA  WG + D  G
Sbjct: 64  VSIPAQSAAIFESSSMSYILPIAECDLRLTLEDKGVLNAVAYAGMTISAIAWGYLADTKG 123

Query: 422 RK 427
           RK
Sbjct: 124 RK 125



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = +1

Query: 520 INGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGM 624
           + G ++ GPA ++FTYL+++ G K R   L +VGM
Sbjct: 157 LGGLVVNGPAAVLFTYLTEMHGPKHRSSVLMIVGM 191


>AE014297-1184|AAF54546.3|  563|Drosophila melanogaster CG31272-PA
           protein.
          Length = 563

 Score = 49.2 bits (112), Expect = 6e-06
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +2

Query: 245 VRVPFFASGV-QNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFG 421
           V +P  ++ + ++  MSY+LP A C+L+LT    G++N    +G   SA  WG + D  G
Sbjct: 64  VSIPAQSAAIFESSSMSYILPIAECDLRLTLEDKGVLNAVAYAGMTISAIAWGYLADTKG 123

Query: 422 RK 427
           RK
Sbjct: 124 RK 125



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = +1

Query: 520 INGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGM 624
           + G ++ GPA ++FTYL+++ G K R   L +VGM
Sbjct: 157 LGGLVVNGPAAVLFTYLTEMHGPKHRSSVLMIVGM 191


>AY113212-1|AAM29217.1|  510|Drosophila melanogaster AT07117p
           protein.
          Length = 510

 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +SYV+P+A C+L L+    G+++    +G + SA  WG + D  GR+
Sbjct: 49  LSYVMPSAECDLDLSIVDKGMLHAVTYAGMIISAVPWGFIADTIGRR 95



 Score = 31.5 bits (68), Expect = 1.4
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
 Frame = +1

Query: 445 VAPGCSDNFSPKHRSRLQTSA---AARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSM 615
           ++ G  D F     S  Q +A   A +  +G II GP  +V +YL++  G K R + +  
Sbjct: 99  ISGGWLDGFFVLCASLSQNTAQLMAFKFFDGLIICGPFAVVVSYLAEFHGKKHRPYIMLF 158

Query: 616 VGM 624
           VG+
Sbjct: 159 VGL 161



 Score = 30.7 bits (66), Expect = 2.4
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +3

Query: 162 DATEEMADYETALDKAGYGRFSRSALGACV-CLSS 263
           D T+E AD+ETA+ + G+G F+   L + V CL++
Sbjct: 7   DNTDEPADFETAIAECGFGLFNVFILCSAVPCLTA 41


>AE014297-1183|AAO41541.1|  510|Drosophila melanogaster CG14691-PB,
           isoform B protein.
          Length = 510

 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +SYV+P+A C+L L+    G+++    +G + SA  WG + D  GR+
Sbjct: 49  LSYVMPSAECDLDLSIVDKGMLHAVTYAGMIISAVPWGFIADTIGRR 95



 Score = 31.5 bits (68), Expect = 1.4
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
 Frame = +1

Query: 445 VAPGCSDNFSPKHRSRLQTSA---AARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSM 615
           ++ G  D F     S  Q +A   A +  +G II GP  +V +YL++  G K R + +  
Sbjct: 99  ISGGWLDGFFVLCASLSQNTAQLMAFKFFDGLIICGPFAVVVSYLAEFHGKKHRPYIMLF 158

Query: 616 VGM 624
           VG+
Sbjct: 159 VGL 161



 Score = 30.7 bits (66), Expect = 2.4
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +3

Query: 162 DATEEMADYETALDKAGYGRFSRSALGACV-CLSS 263
           D T+E AD+ETA+ + G+G F+   L + V CL++
Sbjct: 7   DNTDEPADFETAIAECGFGLFNVFILCSAVPCLTA 41


>AE014297-1182|AAF54545.2|  522|Drosophila melanogaster CG14691-PA,
           isoform A protein.
          Length = 522

 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +SYV+P+A C+L L+    G+++    +G + SA  WG + D  GR+
Sbjct: 49  LSYVMPSAECDLDLSIVDKGMLHAVTYAGMIISAVPWGFIADTIGRR 95



 Score = 31.5 bits (68), Expect = 1.4
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
 Frame = +1

Query: 445 VAPGCSDNFSPKHRSRLQTSA---AARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSM 615
           ++ G  D F     S  Q +A   A +  +G II GP  +V +YL++  G K R + +  
Sbjct: 99  ISGGWLDGFFVLCASLSQNTAQLMAFKFFDGLIICGPFAVVVSYLAEFHGKKHRPYIMLF 158

Query: 616 VGM 624
           VG+
Sbjct: 159 VGL 161



 Score = 30.7 bits (66), Expect = 2.4
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +3

Query: 162 DATEEMADYETALDKAGYGRFSRSALGACV-CLSS 263
           D T+E AD+ETA+ + G+G F+   L + V CL++
Sbjct: 7   DNTDEPADFETAIAECGFGLFNVFILCSAVPCLTA 41


>BT024204-1|ABC86266.1|  513|Drosophila melanogaster RE45749p
           protein.
          Length = 513

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 17/81 (20%), Positives = 37/81 (45%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXX 466
           MSY+   ++C+ ++ +    +++ A   G   S++FWG + D  GR+             
Sbjct: 60  MSYITIVSQCDFEMNSMDKAVMSAASFIGIFCSSYFWGYLSDTIGRRPVLIYTTIAGNFL 119

Query: 467 XXXQSTVPDYRLLLQLEPSMG 529
               + +P+Y L + +   +G
Sbjct: 120 SLCSTVIPNYWLYVFIRFGVG 140


>AE014297-3738|AAN14042.1|  515|Drosophila melanogaster CG31106-PA
           protein.
          Length = 515

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 17/81 (20%), Positives = 37/81 (45%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXX 466
           MSY+   ++C+ ++ +    +++ A   G   S++FWG + D  GR+             
Sbjct: 60  MSYITIVSQCDFEMNSMDKAVMSAASFIGIFCSSYFWGYLSDTIGRRPVLIYTTIAGNFL 119

Query: 467 XXXQSTVPDYRLLLQLEPSMG 529
               + +P+Y L + +   +G
Sbjct: 120 SLCSTVIPNYWLYVFIRFGVG 140


>AY071447-1|AAL49069.1|  478|Drosophila melanogaster RE53026p
           protein.
          Length = 478

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 22/91 (24%), Positives = 38/91 (41%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXX 436
           + +  ++  I+S + P+  CE  +T +Q   +      G + S+ FW  + + +GRKS  
Sbjct: 66  WMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSAL 125

Query: 437 XXXXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                         S  P Y  LL L   +G
Sbjct: 126 TLFGVLLVLYSILSSVAPSYAWLLTLRGLVG 156


>AE013599-3770|AAF47135.2|  478|Drosophila melanogaster CG4324-PA
           protein.
          Length = 478

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 22/91 (24%), Positives = 38/91 (41%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXX 436
           + +  ++  I+S + P+  CE  +T +Q   +      G + S+ FW  + + +GRKS  
Sbjct: 66  WMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSAL 125

Query: 437 XXXXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                         S  P Y  LL L   +G
Sbjct: 126 TLFGVLLVLYSILSSVAPSYAWLLTLRGLVG 156


>AE014297-3739|AAF56418.2|  360|Drosophila melanogaster CG31103-PA
           protein.
          Length = 360

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 15/47 (31%), Positives = 28/47 (59%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           MS ++ A++CE + T  + G++  A ++G   S + WG + D  GR+
Sbjct: 51  MSIIVIASQCEFETTQAEKGVMMAASVTGIFLSTYIWGYISDDIGRR 97



 Score = 32.7 bits (71), Expect = 0.59
 Identities = 15/28 (53%), Positives = 17/28 (60%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           F PWRL L    LPGF+    +LY PES
Sbjct: 193 FRPWRLLLLVSLLPGFIGGLILLYYPES 220


>BT001333-1|AAN71088.1|  471|Drosophila melanogaster AT19445p
           protein.
          Length = 471

 Score = 37.5 bits (83), Expect = 0.021
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           M  + PAA C+L++   Q   +  A   G + S++FWG + D  GR+
Sbjct: 10  MGIIGPAAVCDLRMNEAQLASLTAAGFMGIICSSYFWGYITDKKGRR 56


>AE014297-2239|AAF55340.1|  460|Drosophila melanogaster CG12783-PA
           protein.
          Length = 460

 Score = 37.5 bits (83), Expect = 0.021
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           M  + PAA C+L++   Q   +  A   G + S++FWG + D  GR+
Sbjct: 10  MGIIGPAAVCDLRMNEAQLASLTAAGFMGIICSSYFWGYITDKKGRR 56


>BT029691-1|ABL75748.1|  247|Drosophila melanogaster IP17413p
           protein.
          Length = 247

 Score = 33.1 bits (72), Expect = 0.45
 Identities = 14/67 (20%), Positives = 29/67 (43%)
 Frame = +2

Query: 296 VLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXXXXX 475
           ++  A CE+++   +   +  A  +  + S F WG + DV+GR+                
Sbjct: 41  IIAGASCEMRIHDRRLAWLMAASFAAQMVSCFLWGELADVYGRRKIIMITSTVANIVSIL 100

Query: 476 QSTVPDY 496
            + VP++
Sbjct: 101 SACVPEF 107


>BT029666-1|ABL75723.1|  247|Drosophila melanogaster IP17313p
           protein.
          Length = 247

 Score = 33.1 bits (72), Expect = 0.45
 Identities = 14/67 (20%), Positives = 29/67 (43%)
 Frame = +2

Query: 296 VLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXXXXX 475
           ++  A CE+++   +   +  A  +  + S F WG + DV+GR+                
Sbjct: 41  IIAGASCEMRIHDRRLAWLMAASFAAQMVSCFLWGELADVYGRRKIIMITSTVANIVSIL 100

Query: 476 QSTVPDY 496
            + VP++
Sbjct: 101 SACVPEF 107


>AE014296-503|AAS64950.1|  342|Drosophila melanogaster CG33234-PA
           protein.
          Length = 342

 Score = 33.1 bits (72), Expect = 0.45
 Identities = 14/67 (20%), Positives = 29/67 (43%)
 Frame = +2

Query: 296 VLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXXXXXXXXXXXXX 475
           ++  A CE+++   +   +  A  +  + S F WG + DV+GR+                
Sbjct: 41  IIAGASCEMRIHDRRLAWLMAASFAAQMVSCFLWGELADVYGRRKIIMITSTVANIVSIL 100

Query: 476 QSTVPDY 496
            + VP++
Sbjct: 101 SACVPEF 107


>AY113278-1|AAM29283.1|  151|Drosophila melanogaster AT17820p
           protein.
          Length = 151

 Score = 32.3 bits (70), Expect = 0.79
 Identities = 20/93 (21%), Positives = 37/93 (39%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXX 436
           +  S  ++    Y++    CE   +  +  L+  + + G VAS  F G + D +GRK   
Sbjct: 30  YMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVI 89

Query: 437 XXXXXXXXXXXXXQSTVPDYRLLLQLEPSMGSL 535
                         + +PD   L  +   +G+L
Sbjct: 90  RLALVGALSFSVISALMPDLYSLSVIRIIVGTL 122


>AE014296-502|AAN11521.1|  151|Drosophila melanogaster CG33233-PB,
           isoform B protein.
          Length = 151

 Score = 32.3 bits (70), Expect = 0.79
 Identities = 20/93 (21%), Positives = 37/93 (39%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXX 436
           +  S  ++    Y++    CE   +  +  L+  + + G VAS  F G + D +GRK   
Sbjct: 30  YMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVI 89

Query: 437 XXXXXXXXXXXXXQSTVPDYRLLLQLEPSMGSL 535
                         + +PD   L  +   +G+L
Sbjct: 90  RLALVGALSFSVISALMPDLYSLSVIRIIVGTL 122


>BT003805-1|AAO41488.1|  489|Drosophila melanogaster AT15560p
           protein.
          Length = 489

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +  S  ++    Y++    CE   +  +  L+  + + G VAS  F G + D +GRK
Sbjct: 30  YMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGRK 86


>AE014296-501|AAS64949.1|  488|Drosophila melanogaster CG33233-PA,
           isoform A protein.
          Length = 488

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           +  S  ++    Y++    CE   +  +  L+  + + G VAS  F G + D +GRK
Sbjct: 30  YMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGRK 86


>AE014298-1677|AAF48086.1|  529|Drosophila melanogaster CG15221-PA
           protein.
          Length = 529

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +2

Query: 287 MSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGR 424
           +S ++   +C+LQ T  Q G++  A   G V S+   G + D +GR
Sbjct: 52  VSLIMNQMKCDLQPTLNQQGILASAGFLGVVLSSHAMGFLADTWGR 97


>AY089580-1|AAL90318.1|  667|Drosophila melanogaster RE11206p
           protein.
          Length = 667

 Score = 29.1 bits (62), Expect = 7.3
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = +2

Query: 92  QNNGSENRPENRKPHSQRHGNLTRCHRRDGGLRNRAGQSRVRPL 223
           +NNG  N     +   Q+  +  R   R GGLRN +G + + P+
Sbjct: 555 RNNGQSNWSRYEQRGGQQGSSTARNGSRRGGLRNGSGAAGIGPI 598


>AE014297-3169|AAF56010.1|  126|Drosophila melanogaster CG7045-PA
           protein.
          Length = 126

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 6/70 (8%)
 Frame = +3

Query: 90  PKIMVQKIAPKIGSPIHRGMATS------LDATEEMADYETALDKAGYGRFSRSALGACV 251
           P   VQ+++ K G  + R MA          AT  MA+Y+  L +  + +  R +   C+
Sbjct: 32  PDFSVQEVSVK-GGEMWRAMADEDKIVWQESATTAMAEYKEKLKQWNFPKEHRFSDTQCI 90

Query: 252 CLSSHQECRT 281
           C S+  +C T
Sbjct: 91  CSSNTNQCPT 100


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 40,037,668
Number of Sequences: 53049
Number of extensions: 959942
Number of successful extensions: 2432
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 2303
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2432
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3695805360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).