SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30025
         (734 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY119553-1|AAM50207.1|  878|Drosophila melanogaster GH27971p pro...    29   8.7  
AF020349-1|AAC15518.1|  756|Drosophila melanogaster CROL GAMMA p...    29   8.7  
AF020348-1|AAC15517.1|  891|Drosophila melanogaster CROL BETA pr...    29   8.7  
AF020347-1|AAC15516.1|  962|Drosophila melanogaster CROL ALPHA p...    29   8.7  
AE014134-2098|AAF53121.2|  962|Drosophila melanogaster CG14938-P...    29   8.7  
AE014134-2097|AAN10786.1|  891|Drosophila melanogaster CG14938-P...    29   8.7  
AE014134-2096|AAN10785.1|  878|Drosophila melanogaster CG14938-P...    29   8.7  
AE014134-2095|AAN10784.1|  756|Drosophila melanogaster CG14938-P...    29   8.7  

>AY119553-1|AAM50207.1|  878|Drosophila melanogaster GH27971p
           protein.
          Length = 878

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = -3

Query: 690 NLLGKPFSNDMVSFSHKSLCHCRIEPINLESCFK 589
           N+  KPF+      +H S CH    P   E+C K
Sbjct: 532 NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK 565


>AF020349-1|AAC15518.1|  756|Drosophila melanogaster CROL GAMMA
           protein.
          Length = 756

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = -3

Query: 690 NLLGKPFSNDMVSFSHKSLCHCRIEPINLESCFK 589
           N+  KPF+      +H S CH    P   E+C K
Sbjct: 410 NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK 443


>AF020348-1|AAC15517.1|  891|Drosophila melanogaster CROL BETA
           protein.
          Length = 891

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = -3

Query: 690 NLLGKPFSNDMVSFSHKSLCHCRIEPINLESCFK 589
           N+  KPF+      +H S CH    P   E+C K
Sbjct: 616 NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK 649


>AF020347-1|AAC15516.1|  962|Drosophila melanogaster CROL ALPHA
           protein.
          Length = 962

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = -3

Query: 690 NLLGKPFSNDMVSFSHKSLCHCRIEPINLESCFK 589
           N+  KPF+      +H S CH    P   E+C K
Sbjct: 616 NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK 649


>AE014134-2098|AAF53121.2|  962|Drosophila melanogaster CG14938-PA,
           isoform A protein.
          Length = 962

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = -3

Query: 690 NLLGKPFSNDMVSFSHKSLCHCRIEPINLESCFK 589
           N+  KPF+      +H S CH    P   E+C K
Sbjct: 616 NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK 649


>AE014134-2097|AAN10786.1|  891|Drosophila melanogaster CG14938-PB,
           isoform B protein.
          Length = 891

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = -3

Query: 690 NLLGKPFSNDMVSFSHKSLCHCRIEPINLESCFK 589
           N+  KPF+      +H S CH    P   E+C K
Sbjct: 616 NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK 649


>AE014134-2096|AAN10785.1|  878|Drosophila melanogaster CG14938-PD,
           isoform D protein.
          Length = 878

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = -3

Query: 690 NLLGKPFSNDMVSFSHKSLCHCRIEPINLESCFK 589
           N+  KPF+      +H S CH    P   E+C K
Sbjct: 532 NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK 565


>AE014134-2095|AAN10784.1|  756|Drosophila melanogaster CG14938-PC,
           isoform C protein.
          Length = 756

 Score = 28.7 bits (61), Expect = 8.7
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = -3

Query: 690 NLLGKPFSNDMVSFSHKSLCHCRIEPINLESCFK 589
           N+  KPF+      +H S CH    P   E+C K
Sbjct: 410 NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK 443


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,614,550
Number of Sequences: 53049
Number of extensions: 572025
Number of successful extensions: 1038
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1002
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1038
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3314233461
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).