SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY070994-1|AAL48616.1|  262|Drosophila melanogaster RE08669p pro...   120   1e-27
AE014297-4764|AAF57167.1|  262|Drosophila melanogaster CG11522-P...   120   1e-27
AE014297-4763|AAF57166.1|  243|Drosophila melanogaster CG11522-P...   120   1e-27

>AY070994-1|AAL48616.1|  262|Drosophila melanogaster RE08669p
           protein.
          Length = 262

 Score =  120 bits (289), Expect = 1e-27
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV ILLAGRH GKRVVL+ +L SGLLLVTGPFA NSCPLRR+ QRYVIGTS+++ LG F
Sbjct: 117 GTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAF 176

Query: 444 KLPKHFNDDYFKKNK-KCVKRTVNA 515
           K+P+H ND YF++ K K  K+T  A
Sbjct: 177 KVPEHLNDAYFRRLKAKKDKKTGEA 201



 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 31/85 (36%), Positives = 47/85 (55%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKAKYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRRKSFY 180
           G++R+SK++M+ ++A Y+                  VK+IGG KNGG RTV LK+ K+ Y
Sbjct: 29  GILRYSKAQMYKRRALYRLKDKKSPVVEKAKVPIKKVKKIGGPKNGGERTVFLKKSKASY 88

Query: 181 PTQEKIRASSGGRPFSKHVRRIRPN 255
           PT+  ++       FS+H R  R N
Sbjct: 89  PTKTFVKKRPSKANFSEHKRNTRRN 113


>AE014297-4764|AAF57167.1|  262|Drosophila melanogaster CG11522-PB,
           isoform B protein.
          Length = 262

 Score =  120 bits (289), Expect = 1e-27
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV ILLAGRH GKRVVL+ +L SGLLLVTGPFA NSCPLRR+ QRYVIGTS+++ LG F
Sbjct: 117 GTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAF 176

Query: 444 KLPKHFNDDYFKKNK-KCVKRTVNA 515
           K+P+H ND YF++ K K  K+T  A
Sbjct: 177 KVPEHLNDAYFRRLKAKKDKKTGEA 201



 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 31/85 (36%), Positives = 47/85 (55%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKAKYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRRKSFY 180
           G++R+SK++M+ ++A Y+                  VK+IGG KNGG RTV LK+ K+ Y
Sbjct: 29  GILRYSKAQMYKRRALYRLKDKKSPVVEKAKVPIKKVKKIGGPKNGGERTVFLKKSKASY 88

Query: 181 PTQEKIRASSGGRPFSKHVRRIRPN 255
           PT+  ++       FS+H R  R N
Sbjct: 89  PTKTFVKKRPSKANFSEHKRNTRRN 113


>AE014297-4763|AAF57166.1|  243|Drosophila melanogaster CG11522-PA,
           isoform A protein.
          Length = 243

 Score =  120 bits (289), Expect = 1e-27
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV ILLAGRH GKRVVL+ +L SGLLLVTGPFA NSCPLRR+ QRYVIGTS+++ LG F
Sbjct: 98  GTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAF 157

Query: 444 KLPKHFNDDYFKKNK-KCVKRTVNA 515
           K+P+H ND YF++ K K  K+T  A
Sbjct: 158 KVPEHLNDAYFRRLKAKKDKKTGEA 182



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +1

Query: 151 VPLKRRKSFYPTQEKIRASSGGRPFSKHVRRIRPN 255
           VP+K+ K+ YPT+  ++       FS+H R  R N
Sbjct: 60  VPIKKSKASYPTKTFVKKRPSKANFSEHKRNTRRN 94


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,814,716
Number of Sequences: 53049
Number of extensions: 525696
Number of successful extensions: 1546
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1510
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1546
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 2053700352
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).