SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y10618-2|CAA71628.1|  299|Drosophila melanogaster ADP/ATP transl...   138   6e-33
BT011069-1|AAR31140.1|  299|Drosophila melanogaster GH27591p pro...   138   6e-33
AY070894-1|AAL48516.1|  299|Drosophila melanogaster LP02726p pro...   138   6e-33
AY060978-1|AAL28526.1|  299|Drosophila melanogaster GM12886p pro...   138   6e-33
AE014298-1497|AAF47957.1|  299|Drosophila melanogaster CG16944-P...   138   6e-33
AE014298-1496|AAG22341.1|  299|Drosophila melanogaster CG16944-P...   138   6e-33
AE014298-1495|AAN09268.1|  312|Drosophila melanogaster CG16944-P...   138   6e-33
AE014298-1494|AAN09267.1|  312|Drosophila melanogaster CG16944-P...   138   6e-33
S43651-1|AAB23114.1|  297|Drosophila melanogaster ADP/ATP transl...   134   2e-31
S71762-1|AAB31734.3|  297|Drosophila melanogaster ADP/ATP transl...   129   4e-30
Y10618-1|CAA71629.1|  307|Drosophila melanogaster ADP/ATP transl...   117   2e-26
AE014298-1493|AAO41648.1|  307|Drosophila melanogaster CG1683-PB...   117   2e-26
AE014298-1492|AAF47956.1|  307|Drosophila melanogaster CG1683-PA...   117   2e-26
AY071345-1|AAL48967.1|  303|Drosophila melanogaster RE38146p pro...    38   0.020
AE013599-1831|AAF58288.1|  303|Drosophila melanogaster CG8323-PA...    38   0.020
BT001798-1|AAN71553.1|  317|Drosophila melanogaster RH27308p pro...    36   0.061
BT001438-1|AAN71193.1|  392|Drosophila melanogaster GH24658p pro...    36   0.061
AY069117-1|AAL39262.1|  399|Drosophila melanogaster GH13054p pro...    36   0.061
AY061503-1|AAL29051.1|  317|Drosophila melanogaster LD46175p pro...    36   0.061
AY060332-1|AAL25371.1|  304|Drosophila melanogaster GH22139p pro...    36   0.061
AE014297-1317|AAN13510.2|  317|Drosophila melanogaster CG6782-PE...    36   0.061
AE014297-1316|AAF54654.1|  317|Drosophila melanogaster CG6782-PD...    36   0.061
AE014297-1315|AAN13509.1|  317|Drosophila melanogaster CG6782-PC...    36   0.061
AE014297-1314|AAN13508.1|  317|Drosophila melanogaster CG6782-PA...    36   0.061
AE014134-1837|AAF52912.1|  360|Drosophila melanogaster CG4995-PC...    36   0.061
AE014134-1836|AAN10743.1|  399|Drosophila melanogaster CG4995-PB...    36   0.061
AE014134-1835|AAF52911.1|  399|Drosophila melanogaster CG4995-PA...    36   0.061
AE013599-822|AAM68821.1|  304|Drosophila melanogaster CG8026-PB,...    36   0.061
AE013599-821|AAF58969.1|  360|Drosophila melanogaster CG8026-PA,...    36   0.061
AY089345-1|AAL90083.1|  335|Drosophila melanogaster AT16588p pro...    35   0.11 
AY051574-1|AAK92998.1|  339|Drosophila melanogaster GH22160p pro...    35   0.11 
AE014297-3625|AAF56335.1|  339|Drosophila melanogaster CG5805-PA...    35   0.11 
AE014134-1001|AAF52313.1|  335|Drosophila melanogaster CG9064-PA...    35   0.11 
AY075266-1|AAL68133.1|  300|Drosophila melanogaster AT23224p pro...    35   0.14 
AE014134-1600|AAF52742.1|  300|Drosophila melanogaster CG9582-PA...    35   0.14 
BT023526-1|AAY84926.1|  301|Drosophila melanogaster IP09951p pro...    34   0.19 
AE013599-1832|AAF58287.1|  304|Drosophila melanogaster CG18327-P...    34   0.19 
BT024270-1|ABC86332.1|  337|Drosophila melanogaster IP15246p pro...    33   0.43 
AY060454-1|AAL25493.1|  199|Drosophila melanogaster SD01736p pro...    33   0.43 
AE014134-1002|AAF52314.1|  337|Drosophila melanogaster CG18340-P...    33   0.43 
AE013599-1834|AAF58286.2|  199|Drosophila melanogaster CG18324-P...    33   0.43 
AE013599-1833|AAM70987.1|  307|Drosophila melanogaster CG18324-P...    33   0.43 
AY069591-1|AAL39736.1|  299|Drosophila melanogaster LD34154p pro...    32   0.76 
AM294746-1|CAL26732.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294745-1|CAL26731.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294744-1|CAL26730.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294743-1|CAL26729.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294742-1|CAL26728.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294741-1|CAL26727.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294740-1|CAL26726.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294739-1|CAL26725.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294738-1|CAL26724.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294737-1|CAL26723.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AM294736-1|CAL26722.1|  299|Drosophila melanogaster CG3476 protein.    32   0.76 
AE014134-1218|AAF52476.1|  299|Drosophila melanogaster CG3476-PA...    32   0.76 
BT021264-1|AAX33412.1|  365|Drosophila melanogaster RE52377p pro...    32   1.0  
AL132792-2|CAB60031.1|  306|Drosophila melanogaster EG:BACR19J1....    32   1.0  
AE014298-100|AAF45544.1|  306|Drosophila melanogaster CG5254-PA ...    32   1.0  
AE014297-2806|AAN14352.3|  290|Drosophila melanogaster CG4241-PB...    32   1.0  
AE014297-2805|AAS65181.1|  365|Drosophila melanogaster CG4241-PC...    32   1.0  
AE014297-2804|AAF55774.2|  365|Drosophila melanogaster CG4241-PA...    32   1.0  
Y12495-1|CAA73099.1|  306|Drosophila melanogaster colt protein.        31   1.3  
AY069277-1|AAL39422.1|  306|Drosophila melanogaster GM13207p pro...    31   1.3  
AE014134-470|AAS64624.1|  306|Drosophila melanogaster CG3057-PD,...    31   1.3  
AE014134-469|AAS64623.1|  306|Drosophila melanogaster CG3057-PC,...    31   1.3  
AE014134-468|AAS64622.1|  306|Drosophila melanogaster CG3057-PB,...    31   1.3  
AE014134-467|AAF51209.1|  306|Drosophila melanogaster CG3057-PA,...    31   1.3  
AY051504-1|AAK92928.1|  421|Drosophila melanogaster GH15472p pro...    30   4.0  
AE014298-2303|AAF48551.1|  421|Drosophila melanogaster CG8931-PA...    30   4.0  
AY069712-1|AAL39857.1|  332|Drosophila melanogaster LP01207p pro...    29   7.1  
AE014297-1415|AAF54726.2|  319|Drosophila melanogaster CG12201-P...    29   7.1  
AE014297-1229|AAF54576.2|  332|Drosophila melanogaster CG6608-PB...    29   7.1  
AE014297-1228|AAF54575.1|  332|Drosophila melanogaster CG6608-PA...    29   7.1  
AE014297-2654|AAF55660.2|  237|Drosophila melanogaster CG31245-P...    29   9.3  

>Y10618-2|CAA71628.1|  299|Drosophila melanogaster ADP/ATP
           translocase protein.
          Length = 299

 Score =  138 bits (335), Expect = 6e-33
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK EGT  FFKGAFSN+LRGTGGA
Sbjct: 227 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGA 286

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 287 FVLVLYDEIKKVL 299



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR 82


>BT011069-1|AAR31140.1|  299|Drosophila melanogaster GH27591p
           protein.
          Length = 299

 Score =  138 bits (335), Expect = 6e-33
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK EGT  FFKGAFSN+LRGTGGA
Sbjct: 227 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGA 286

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 287 FVLVLYDEIKKVL 299



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR 82


>AY070894-1|AAL48516.1|  299|Drosophila melanogaster LP02726p
           protein.
          Length = 299

 Score =  138 bits (335), Expect = 6e-33
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK EGT  FFKGAFSN+LRGTGGA
Sbjct: 227 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGA 286

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 287 FVLVLYDEIKKVL 299



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR 82


>AY060978-1|AAL28526.1|  299|Drosophila melanogaster GM12886p
           protein.
          Length = 299

 Score =  138 bits (335), Expect = 6e-33
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK EGT  FFKGAFSN+LRGTGGA
Sbjct: 227 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGA 286

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 287 FVLVLYDEIKKVL 299



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR 82


>AE014298-1497|AAF47957.1|  299|Drosophila melanogaster CG16944-PB,
           isoform B protein.
          Length = 299

 Score =  138 bits (335), Expect = 6e-33
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK EGT  FFKGAFSN+LRGTGGA
Sbjct: 227 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGA 286

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 287 FVLVLYDEIKKVL 299



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR 82


>AE014298-1496|AAG22341.1|  299|Drosophila melanogaster CG16944-PA,
           isoform A protein.
          Length = 299

 Score =  138 bits (335), Expect = 6e-33
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK EGT  FFKGAFSN+LRGTGGA
Sbjct: 227 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGA 286

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 287 FVLVLYDEIKKVL 299



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR 82


>AE014298-1495|AAN09268.1|  312|Drosophila melanogaster CG16944-PD,
           isoform D protein.
          Length = 312

 Score =  138 bits (335), Expect = 6e-33
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK EGT  FFKGAFSN+LRGTGGA
Sbjct: 240 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGA 299

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 300 FVLVLYDEIKKVL 312



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 43  PIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR 95


>AE014298-1494|AAN09267.1|  312|Drosophila melanogaster CG16944-PC,
           isoform C protein.
          Length = 312

 Score =  138 bits (335), Expect = 6e-33
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK EGT  FFKGAFSN+LRGTGGA
Sbjct: 240 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGA 299

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 300 FVLVLYDEIKKVL 312



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 43  PIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR 95


>S43651-1|AAB23114.1|  297|Drosophila melanogaster ADP/ATP
           translocase protein.
          Length = 297

 Score =  134 bits (323), Expect = 2e-31
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK EG S FFKGAFSN+LRGTGGA
Sbjct: 226 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGPS-FFKGAFSNILRGTGGA 284

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 285 FVLVLYDEIKKVL 297


>S71762-1|AAB31734.3|  297|Drosophila melanogaster ADP/ATP
           translocase protein.
          Length = 297

 Score =  129 bits (312), Expect = 4e-30
 Identities = 59/73 (80%), Positives = 66/73 (90%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGR  ++++YKNT+HCWATIAK E    FFKGAFSN+LRGTGGA
Sbjct: 226 IVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEAPC-FFKGAFSNILRGTGGA 284

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDEIKKVL
Sbjct: 285 FVLVLYDEIKKVL 297



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 30  PIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR 82


>Y10618-1|CAA71629.1|  307|Drosophila melanogaster ADP/ATP
           translocase protein.
          Length = 307

 Score =  117 bits (282), Expect = 2e-26
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I SYPFDTVRRRMMMQSG  KS+++YKNT HCW  IAK EG   FFKGA SN++RGTGGA
Sbjct: 235 IASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGA 294

Query: 181 FVLVLYDEIKK 213
            VL LYDE+KK
Sbjct: 295 LVLALYDEMKK 305



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 38  PIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLANVIR 90


>AE014298-1493|AAO41648.1|  307|Drosophila melanogaster CG1683-PB,
           isoform B protein.
          Length = 307

 Score =  117 bits (282), Expect = 2e-26
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I SYPFDTVRRRMMMQSG  KS+++YKNT HCW  IAK EG   FFKGA SN++RGTGGA
Sbjct: 235 IASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGA 294

Query: 181 FVLVLYDEIKK 213
            VL LYDE+KK
Sbjct: 295 LVLALYDEMKK 305



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 38  PIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLANVIR 90


>AE014298-1492|AAF47956.1|  307|Drosophila melanogaster CG1683-PA,
           isoform A protein.
          Length = 307

 Score =  117 bits (282), Expect = 2e-26
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I SYPFDTVRRRMMMQSG  KS+++YKNT HCW  IAK EG   FFKGA SN++RGTGGA
Sbjct: 235 IASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGA 294

Query: 181 FVLVLYDEIKK 213
            VL LYDE+KK
Sbjct: 295 LVLALYDEMKK 305



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C+  I K +G S F++G  +NV+R
Sbjct: 38  PIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLANVIR 90


>AY071345-1|AAL48967.1|  303|Drosophila melanogaster RE38146p
           protein.
          Length = 303

 Score = 37.5 bits (83), Expect = 0.020
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 2/70 (2%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFV 186
           P D +  R+  Q   A+   +LY+  + C+  I ++EG    +KG ++N LR       V
Sbjct: 227 PPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLV 286

Query: 187 LVLYDEIKKV 216
           L+ +DE+  V
Sbjct: 287 LLFFDELVAV 296


>AE013599-1831|AAF58288.1|  303|Drosophila melanogaster CG8323-PA
           protein.
          Length = 303

 Score = 37.5 bits (83), Expect = 0.020
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 2/70 (2%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFV 186
           P D +  R+  Q   A+   +LY+  + C+  I ++EG    +KG ++N LR       V
Sbjct: 227 PPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLV 286

Query: 187 LVLYDEIKKV 216
           L+ +DE+  V
Sbjct: 287 LLFFDELVAV 296


>BT001798-1|AAN71553.1|  317|Drosophila melanogaster RH27308p
           protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D V+ RM    G   S   YKNT HC   I K EG + F+KG    + R     A   
Sbjct: 248 PLDVVKTRMQ---GLEASK--YKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITF 302

Query: 190 VLYD 201
           ++YD
Sbjct: 303 MIYD 306


>BT001438-1|AAN71193.1|  392|Drosophila melanogaster GH24658p
           protein.
          Length = 392

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           P +  + R+ + S +  S I +   IHC   I KTEG    FKG  + +LR   G
Sbjct: 145 PMELAKTRLQL-STQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPG 198



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-- 174
           ++ +PFDTV+  +     R      YK T HC+ TI + +     ++G  S+ + G G  
Sbjct: 49  LVGHPFDTVKVHLQTDDPRNPK---YKGTFHCFRTIVQRDKFIGLYRG-ISSPMGGIGLV 104

Query: 175 GAFVLVLYDEIKKV 216
            A V  +Y  ++++
Sbjct: 105 NAIVFGVYGNVQRL 118


>AY069117-1|AAL39262.1|  399|Drosophila melanogaster GH13054p
           protein.
          Length = 399

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           P +  + R+ + S +  S I +   IHC   I KTEG    FKG  + +LR   G
Sbjct: 152 PMELAKTRLQL-STQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPG 205



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-- 174
           ++ +PFDTV+  +     R      YK T HC+ TI + +     ++G  S+ + G G  
Sbjct: 56  LVGHPFDTVKVHLQTDDPRNPK---YKGTFHCFRTIVQRDKFIGLYRG-ISSPMGGIGLV 111

Query: 175 GAFVLVLYDEIKKV 216
            A V  +Y  ++++
Sbjct: 112 NAIVFGVYGNVQRL 125


>AY061503-1|AAL29051.1|  317|Drosophila melanogaster LD46175p
           protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D V+ RM    G   S   YKNT HC   I K EG + F+KG    + R     A   
Sbjct: 248 PLDVVKTRMQ---GLEASK--YKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITF 302

Query: 190 VLYD 201
           ++YD
Sbjct: 303 MIYD 306


>AY060332-1|AAL25371.1|  304|Drosophila melanogaster GH22139p
           protein.
          Length = 304

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 20/70 (28%), Positives = 34/70 (48%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P   V+ R+ +Q   A S   Y+  IH    I K EG    ++G    +L  + GA
Sbjct: 138 LLTNPIWVVKTRLCLQCDAASS-AEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGA 196

Query: 181 FVLVLYDEIK 210
              + Y+E+K
Sbjct: 197 IQFMTYEELK 206


>AE014297-1317|AAN13510.2|  317|Drosophila melanogaster CG6782-PE,
           isoform E protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D V+ RM    G   S   YKNT HC   I K EG + F+KG    + R     A   
Sbjct: 248 PLDVVKTRMQ---GLEASK--YKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITF 302

Query: 190 VLYD 201
           ++YD
Sbjct: 303 MIYD 306


>AE014297-1316|AAF54654.1|  317|Drosophila melanogaster CG6782-PD,
           isoform D protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D V+ RM    G   S   YKNT HC   I K EG + F+KG    + R     A   
Sbjct: 248 PLDVVKTRMQ---GLEASK--YKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITF 302

Query: 190 VLYD 201
           ++YD
Sbjct: 303 MIYD 306


>AE014297-1315|AAN13509.1|  317|Drosophila melanogaster CG6782-PC,
           isoform C protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D V+ RM    G   S   YKNT HC   I K EG + F+KG    + R     A   
Sbjct: 248 PLDVVKTRMQ---GLEASK--YKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITF 302

Query: 190 VLYD 201
           ++YD
Sbjct: 303 MIYD 306


>AE014297-1314|AAN13508.1|  317|Drosophila melanogaster CG6782-PA,
           isoform A protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D V+ RM    G   S   YKNT HC   I K EG + F+KG    + R     A   
Sbjct: 248 PLDVVKTRMQ---GLEASK--YKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITF 302

Query: 190 VLYD 201
           ++YD
Sbjct: 303 MIYD 306


>AE014134-1837|AAF52912.1|  360|Drosophila melanogaster CG4995-PC,
           isoform C protein.
          Length = 360

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           P +  + R+ + S +  S I +   IHC   I KTEG    FKG  + +LR   G
Sbjct: 113 PMELAKTRLQL-STQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPG 166



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-- 174
           ++ +PFDTV+  +     R      YK T HC+ TI + +     ++G  S+ + G G  
Sbjct: 17  LVGHPFDTVKVHLQTDDPRNPK---YKGTFHCFRTIVQRDKFIGLYRG-ISSPMGGIGLV 72

Query: 175 GAFVLVLYDEIKKV 216
            A V  +Y  ++++
Sbjct: 73  NAIVFGVYGNVQRL 86


>AE014134-1836|AAN10743.1|  399|Drosophila melanogaster CG4995-PB,
           isoform B protein.
          Length = 399

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           P +  + R+ + S +  S I +   IHC   I KTEG    FKG  + +LR   G
Sbjct: 152 PMELAKTRLQL-STQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPG 205



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-- 174
           ++ +PFDTV+  +     R      YK T HC+ TI + +     ++G  S+ + G G  
Sbjct: 56  LVGHPFDTVKVHLQTDDPRNPK---YKGTFHCFRTIVQRDKFIGLYRG-ISSPMGGIGLV 111

Query: 175 GAFVLVLYDEIKKV 216
            A V  +Y  ++++
Sbjct: 112 NAIVFGVYGNVQRL 125


>AE014134-1835|AAF52911.1|  399|Drosophila melanogaster CG4995-PA,
           isoform A protein.
          Length = 399

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           P +  + R+ + S +  S I +   IHC   I KTEG    FKG  + +LR   G
Sbjct: 152 PMELAKTRLQL-STQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPG 205



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-- 174
           ++ +PFDTV+  +     R      YK T HC+ TI + +     ++G  S+ + G G  
Sbjct: 56  LVGHPFDTVKVHLQTDDPRNPK---YKGTFHCFRTIVQRDKFIGLYRG-ISSPMGGIGLV 111

Query: 175 GAFVLVLYDEIKKV 216
            A V  +Y  ++++
Sbjct: 112 NAIVFGVYGNVQRL 125


>AE013599-822|AAM68821.1|  304|Drosophila melanogaster CG8026-PB,
           isoform B protein.
          Length = 304

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 20/70 (28%), Positives = 34/70 (48%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P   V+ R+ +Q   A S   Y+  IH    I K EG    ++G    +L  + GA
Sbjct: 138 LLTNPIWVVKTRLCLQCDAASS-AEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGA 196

Query: 181 FVLVLYDEIK 210
              + Y+E+K
Sbjct: 197 IQFMTYEELK 206


>AE013599-821|AAF58969.1|  360|Drosophila melanogaster CG8026-PA,
           isoform A protein.
          Length = 360

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 20/70 (28%), Positives = 34/70 (48%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P   V+ R+ +Q   A S   Y+  IH    I K EG    ++G    +L  + GA
Sbjct: 138 LLTNPIWVVKTRLCLQCDAASS-AEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGA 196

Query: 181 FVLVLYDEIK 210
              + Y+E+K
Sbjct: 197 IQFMTYEELK 206


>AY089345-1|AAL90083.1|  335|Drosophila melanogaster AT16588p
           protein.
          Length = 335

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQS-GRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           ++S P D ++ RMM Q    +  ++ YKN++ C   + + EG    +KG
Sbjct: 256 VLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKG 304


>AY051574-1|AAK92998.1|  339|Drosophila melanogaster GH22160p
           protein.
          Length = 339

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 17/70 (24%), Positives = 37/70 (52%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVL 189
           +P   ++ ++ +Q    KSD+ YK  + C   I ++EG    ++G + + ++   G F +
Sbjct: 58  FPLTVIKTQLQVQH---KSDV-YKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYI 113

Query: 190 VLYDEIKKVL 219
             Y+ ++ VL
Sbjct: 114 STYEGVRHVL 123


>AE014297-3625|AAF56335.1|  339|Drosophila melanogaster CG5805-PA
           protein.
          Length = 339

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 17/70 (24%), Positives = 37/70 (52%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVL 189
           +P   ++ ++ +Q    KSD+ YK  + C   I ++EG    ++G + + ++   G F +
Sbjct: 58  FPLTVIKTQLQVQH---KSDV-YKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYI 113

Query: 190 VLYDEIKKVL 219
             Y+ ++ VL
Sbjct: 114 STYEGVRHVL 123


>AE014134-1001|AAF52313.1|  335|Drosophila melanogaster CG9064-PA
           protein.
          Length = 335

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQS-GRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           ++S P D ++ RMM Q    +  ++ YKN++ C   + + EG    +KG
Sbjct: 256 VLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKG 304


>AY075266-1|AAL68133.1|  300|Drosophila melanogaster AT23224p
           protein.
          Length = 300

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +1

Query: 61  KSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           K ++ Y+ TI    +  K EG    FKG  + +LR G GGA +LV Y+ + + L
Sbjct: 242 KGEVKYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFL 295


>AE014134-1600|AAF52742.1|  300|Drosophila melanogaster CG9582-PA
           protein.
          Length = 300

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +1

Query: 61  KSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           K ++ Y+ TI    +  K EG    FKG  + +LR G GGA +LV Y+ + + L
Sbjct: 242 KGEVKYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFL 295


>BT023526-1|AAY84926.1|  301|Drosophila melanogaster IP09951p
           protein.
          Length = 301

 Score = 34.3 bits (75), Expect = 0.19
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-GAFV 186
           P D V  R+  Q   A+   I Y+  + C  TI ++EG    +KG +   LR       V
Sbjct: 224 PLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLV 283

Query: 187 LVLYDEI 207
           L+ +DE+
Sbjct: 284 LLFFDEL 290


>AE013599-1832|AAF58287.1|  304|Drosophila melanogaster CG18327-PA
           protein.
          Length = 304

 Score = 34.3 bits (75), Expect = 0.19
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTG-GAFV 186
           P D V  R+  Q   A+   I Y+  + C  TI ++EG    +KG +   LR       V
Sbjct: 227 PLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLV 286

Query: 187 LVLYDEI 207
           L+ +DE+
Sbjct: 287 LLFFDEL 293


>BT024270-1|ABC86332.1|  337|Drosophila melanogaster IP15246p
           protein.
          Length = 337

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 2/73 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQ-SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTG 174
           I+S P D V+ R+M Q +      I YK ++ C + + + EG    +KG     +R G  
Sbjct: 258 ILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPA 317

Query: 175 GAFVLVLYDEIKK 213
                + +++I++
Sbjct: 318 SVVFWMTFEQIRR 330


>AY060454-1|AAL25493.1|  199|Drosophila melanogaster SD01736p
           protein.
          Length = 199

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKG 144
           + + PFD +  RM  Q    K   ++YK  + C+  I +TEG    +KG
Sbjct: 115 VANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKG 163


>AE014134-1002|AAF52314.1|  337|Drosophila melanogaster CG18340-PA,
           isoform A protein.
          Length = 337

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 2/73 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQ-SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTG 174
           I+S P D V+ R+M Q +      I YK ++ C + + + EG    +KG     +R G  
Sbjct: 258 ILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPA 317

Query: 175 GAFVLVLYDEIKK 213
                + +++I++
Sbjct: 318 SVVFWMTFEQIRR 330


>AE013599-1834|AAF58286.2|  199|Drosophila melanogaster CG18324-PA,
           isoform A protein.
          Length = 199

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKG 144
           + + PFD +  RM  Q    K   ++YK  + C+  I +TEG    +KG
Sbjct: 115 VANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKG 163


>AE013599-1833|AAM70987.1|  307|Drosophila melanogaster CG18324-PB,
           isoform B protein.
          Length = 307

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DILYKNTIHCWATIAKTEGTSPFFKG 144
           + + PFD +  RM  Q    K   ++YK  + C+  I +TEG    +KG
Sbjct: 223 VANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKG 271


>AY069591-1|AAL39736.1|  299|Drosophila melanogaster LD34154p
           protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294746-1|CAL26732.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294745-1|CAL26731.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294744-1|CAL26730.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  M  Q+  +   +LY  TI   A + +  G    F+G  + +LR +   
Sbjct: 130 LVTVPTDRIKVLMQTQTV-SNGPLLYNGTIDTAAKLYRQGGNRSLFQGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294743-1|CAL26729.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294742-1|CAL26728.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294741-1|CAL26727.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294740-1|CAL26726.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294739-1|CAL26725.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294738-1|CAL26724.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294737-1|CAL26723.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AM294736-1|CAL26722.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>AE014134-1218|AAF52476.1|  299|Drosophila melanogaster CG3476-PA
           protein.
          Length = 299

 Score = 32.3 bits (70), Expect = 0.76
 Identities = 17/72 (23%), Positives = 36/72 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           +++ P D ++  +  Q+  +   +LY  TI   A + +  G    FKG  + +LR +   
Sbjct: 130 LVTVPTDRIKVLLQTQTV-SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTG 188

Query: 181 FVLVLYDEIKKV 216
           F  V Y+ ++++
Sbjct: 189 FYFVTYEFLQEL 200


>BT021264-1|AAX33412.1|  365|Drosophila melanogaster RE52377p
           protein.
          Length = 365

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGT-SPFFKGAFSNVLRG 168
           SYP D VRRRM            Y   +     I + EG  + F+KG   N ++G
Sbjct: 282 SYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKG 336


>AL132792-2|CAB60031.1|  306|Drosophila melanogaster EG:BACR19J1.2
           protein.
          Length = 306

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 5/77 (6%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQS-----GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           I  P D V+ R+ +Q+       A  ++ Y     C+A + + EG S ++KG    +L  
Sbjct: 31  IMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGIMPPILAE 90

Query: 169 TGGAFVLVLYDEIKKVL 219
           T    +  L  E  K L
Sbjct: 91  TPKRAIKFLVFEQTKPL 107


>AE014298-100|AAF45544.1|  306|Drosophila melanogaster CG5254-PA
           protein.
          Length = 306

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 5/77 (6%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQS-----GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           I  P D V+ R+ +Q+       A  ++ Y     C+A + + EG S ++KG    +L  
Sbjct: 31  IMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGIMPPILAE 90

Query: 169 TGGAFVLVLYDEIKKVL 219
           T    +  L  E  K L
Sbjct: 91  TPKRAIKFLVFEQTKPL 107


>AE014297-2806|AAN14352.3|  290|Drosophila melanogaster CG4241-PB,
           isoform B protein.
          Length = 290

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGT-SPFFKGAFSNVLRG 168
           SYP D VRRRM            Y   +     I + EG  + F+KG   N ++G
Sbjct: 207 SYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKG 261


>AE014297-2805|AAS65181.1|  365|Drosophila melanogaster CG4241-PC,
           isoform C protein.
          Length = 365

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGT-SPFFKGAFSNVLRG 168
           SYP D VRRRM            Y   +     I + EG  + F+KG   N ++G
Sbjct: 282 SYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKG 336


>AE014297-2804|AAF55774.2|  365|Drosophila melanogaster CG4241-PA,
           isoform A protein.
          Length = 365

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%)
 Frame = +1

Query: 7   SYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGT-SPFFKGAFSNVLRG 168
           SYP D VRRRM            Y   +     I + EG  + F+KG   N ++G
Sbjct: 282 SYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKG 336


>Y12495-1|CAA73099.1|  306|Drosophila melanogaster colt protein.
          Length = 306

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDI-LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           +P DT++ R+      A  +  LY+ T  C A   K EG    +KG  S  L G    F 
Sbjct: 34  HPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKG-MSAPLTGVAPIFA 92

Query: 187 L 189
           +
Sbjct: 93  M 93


>AY069277-1|AAL39422.1|  306|Drosophila melanogaster GM13207p
           protein.
          Length = 306

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDI-LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           +P DT++ R+      A  +  LY+ T  C A   K EG    +KG  S  L G    F 
Sbjct: 34  HPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKG-MSAPLTGVAPIFA 92

Query: 187 L 189
           +
Sbjct: 93  M 93


>AE014134-470|AAS64624.1|  306|Drosophila melanogaster CG3057-PD,
           isoform D protein.
          Length = 306

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDI-LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           +P DT++ R+      A  +  LY+ T  C A   K EG    +KG  S  L G    F 
Sbjct: 34  HPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKG-MSAPLTGVAPIFA 92

Query: 187 L 189
           +
Sbjct: 93  M 93


>AE014134-469|AAS64623.1|  306|Drosophila melanogaster CG3057-PC,
           isoform C protein.
          Length = 306

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDI-LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           +P DT++ R+      A  +  LY+ T  C A   K EG    +KG  S  L G    F 
Sbjct: 34  HPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKG-MSAPLTGVAPIFA 92

Query: 187 L 189
           +
Sbjct: 93  M 93


>AE014134-468|AAS64622.1|  306|Drosophila melanogaster CG3057-PB,
           isoform B protein.
          Length = 306

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDI-LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           +P DT++ R+      A  +  LY+ T  C A   K EG    +KG  S  L G    F 
Sbjct: 34  HPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKG-MSAPLTGVAPIFA 92

Query: 187 L 189
           +
Sbjct: 93  M 93


>AE014134-467|AAF51209.1|  306|Drosophila melanogaster CG3057-PA,
           isoform A protein.
          Length = 306

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDI-LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           +P DT++ R+      A  +  LY+ T  C A   K EG    +KG  S  L G    F 
Sbjct: 34  HPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKG-MSAPLTGVAPIFA 92

Query: 187 L 189
           +
Sbjct: 93  M 93


>AY051504-1|AAK92928.1|  421|Drosophila melanogaster GH15472p
           protein.
          Length = 421

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 12/77 (15%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL------------YKNTIHCWATIAKTEGTSPFFKG 144
           ++ +PF+T+  R+ +Q  R   D L            Y+  + C+ T   +EG S  +KG
Sbjct: 287 VMFFPFETILHRLQLQGTRTIIDNLDNGYDVVPILTNYQGVVDCYQTTIVSEGVSGLYKG 346

Query: 145 AFSNVLRGTGGAFVLVL 195
             + +L+      V+ L
Sbjct: 347 FGAMILQFAAHVAVIKL 363


>AE014298-2303|AAF48551.1|  421|Drosophila melanogaster CG8931-PA
           protein.
          Length = 421

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 12/77 (15%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL------------YKNTIHCWATIAKTEGTSPFFKG 144
           ++ +PF+T+  R+ +Q  R   D L            Y+  + C+ T   +EG S  +KG
Sbjct: 287 VMFFPFETILHRLQLQGTRTIIDNLDNGYDVVPILTNYQGVVDCYQTTIVSEGVSGLYKG 346

Query: 145 AFSNVLRGTGGAFVLVL 195
             + +L+      V+ L
Sbjct: 347 FGAMILQFAAHVAVIKL 363


>AY069712-1|AAL39857.1|  332|Drosophila melanogaster LP01207p
           protein.
          Length = 332

 Score = 29.1 bits (62), Expect = 7.1
 Identities = 18/57 (31%), Positives = 29/57 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           IIS P D +R R++ Q   +K    Y+N     + I + EG    ++G  S +L+ T
Sbjct: 154 IISTPLDVIRTRLIAQD-TSKG---YRNATRAVSAIVRQEGPRGMYRGLSSALLQIT 206


>AE014297-1415|AAF54726.2|  319|Drosophila melanogaster CG12201-PB,
           isoform B protein.
          Length = 319

 Score = 29.1 bits (62), Expect = 7.1
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           YP D V+ R+  Q+     + +Y +   C+     +EG    ++G+  N++
Sbjct: 39  YPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAVNIV 89


>AE014297-1229|AAF54576.2|  332|Drosophila melanogaster CG6608-PB,
           isoform B protein.
          Length = 332

 Score = 29.1 bits (62), Expect = 7.1
 Identities = 18/57 (31%), Positives = 29/57 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           IIS P D +R R++ Q   +K    Y+N     + I + EG    ++G  S +L+ T
Sbjct: 154 IISTPLDVIRTRLIAQD-TSKG---YRNATRAVSAIVRQEGPRGMYRGLSSALLQIT 206


>AE014297-1228|AAF54575.1|  332|Drosophila melanogaster CG6608-PA,
           isoform A protein.
          Length = 332

 Score = 29.1 bits (62), Expect = 7.1
 Identities = 18/57 (31%), Positives = 29/57 (50%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           IIS P D +R R++ Q   +K    Y+N     + I + EG    ++G  S +L+ T
Sbjct: 154 IISTPLDVIRTRLIAQD-TSKG---YRNATRAVSAIVRQEGPRGMYRGLSSALLQIT 206


>AE014297-2654|AAF55660.2|  237|Drosophila melanogaster CG31245-PA
           protein.
          Length = 237

 Score = 28.7 bits (61), Expect = 9.3
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = -1

Query: 134 KGEVPSVLAMVAQQWMVFLYRISLLARPD 48
           +GEVP +  M  ++W   L R+  LA+P+
Sbjct: 197 EGEVPRLRKMTPREWRHHLQRLEFLAKPN 225


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,090,088
Number of Sequences: 53049
Number of extensions: 582267
Number of successful extensions: 1236
Number of sequences better than 10.0: 74
Number of HSP's better than 10.0 without gapping: 1170
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1234
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3561257073
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).