SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30022
         (834 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY070616-1|AAL48087.1|  197|Drosophila melanogaster RE71854p pro...    88   1e-17
AE014134-1356|AAF52571.2|  197|Drosophila melanogaster CG14534-P...    88   1e-17
BT028801-1|ABI34182.1|  286|Drosophila melanogaster LP21747p pro...    79   1e-14
BT004476-1|AAO42640.1|  286|Drosophila melanogaster LP07342p pro...    79   1e-14
AE014297-4048|AAF56656.1|  286|Drosophila melanogaster CG5812-PA...    79   1e-14
AJ271041-1|CAB66004.1|  286|Drosophila melanogaster Gly-rich pro...    77   3e-14
AY071066-1|AAL48688.1|  198|Drosophila melanogaster RE14272p pro...    61   2e-09
AE013599-1351|AAF58614.1|  198|Drosophila melanogaster CG8986-PA...    61   2e-09
BT021279-1|AAX33427.1|  392|Drosophila melanogaster RE40185p pro...    60   5e-09
AE014297-4038|AAF56647.1|  360|Drosophila melanogaster CG14254-P...    60   5e-09
AY075518-1|AAL68326.1|  278|Drosophila melanogaster RE68367p pro...    50   5e-06
AE014297-28|AAF52158.1|  278|Drosophila melanogaster CG14643-PA ...    50   5e-06
AE014297-30|AAF52156.1|  251|Drosophila melanogaster CG14640-PA ...    36   0.068
BT022947-1|AAY55363.1|  346|Drosophila melanogaster IP11207p pro...    36   0.090
AE014298-2469|AAN09419.1|  346|Drosophila melanogaster CG32571-P...    36   0.090
AY061275-1|AAL28823.1|  354|Drosophila melanogaster LD19715p pro...    34   0.21 
AE014297-27|AAF52159.1|  354|Drosophila melanogaster CG14639-PA ...    34   0.21 
BT001478-1|AAN71233.1|  308|Drosophila melanogaster LD21452p pro...    33   0.36 
AY118694-1|AAM50554.1|  360|Drosophila melanogaster AT18267p pro...    33   0.36 
AE014298-2473|AAN09422.1|  388|Drosophila melanogaster CG32574-P...    33   0.36 
AE014297-2327|AAF55398.2|  308|Drosophila melanogaster CG4060-PA...    33   0.36 
BT014653-1|AAT27277.1|  247|Drosophila melanogaster RE02040p pro...    33   0.48 
AE014298-2470|AAN09420.1|  247|Drosophila melanogaster CG32570-P...    33   0.48 
AE014298-2471|AAN09421.1|  223|Drosophila melanogaster CG32569-P...    32   1.1  
X62591-1|CAA44476.1|  477|Drosophila melanogaster miniparamyosin...    30   3.4  
X62590-1|CAA44475.1|  879|Drosophila melanogaster standard param...    30   3.4  
X58722-1|CAA41557.1|  878|Drosophila melanogaster paramyosin pro...    30   3.4  
BT016143-1|AAV37028.1| 1240|Drosophila melanogaster AT25839p pro...    30   3.4  
AY051540-1|AAK92964.1|  777|Drosophila melanogaster GH19061p pro...    30   3.4  
AE014296-1516|AAN11995.1|  640|Drosophila melanogaster CG5939-PD...    30   3.4  
AE014296-1515|AAF50371.2|  640|Drosophila melanogaster CG5939-PC...    30   3.4  
AE014296-1514|AAN11994.1|  879|Drosophila melanogaster CG5939-PB...    30   3.4  
AE014296-1513|AAF50370.1|  879|Drosophila melanogaster CG5939-PA...    30   3.4  
AE013599-727|AAF59033.1| 1240|Drosophila melanogaster CG8266-PA,...    30   3.4  
AE013599-726|AAM71085.1| 1241|Drosophila melanogaster CG8266-PB,...    30   3.4  

>AY070616-1|AAL48087.1|  197|Drosophila melanogaster RE71854p
           protein.
          Length = 197

 Score = 88.2 bits (209), Expect = 1e-17
 Identities = 48/103 (46%), Positives = 58/103 (56%), Gaps = 1/103 (0%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAWLHP-RNXXXXXXXXXXXXXXXXXXXXXXXXXNE 607
           P++ KH+YVHVPPPEP E + PR P ++ P +                          NE
Sbjct: 59  PVIHKHVYVHVPPPEP-EYQAPRKPLYVPPPQKHYKIVFIKAPSPPVPTAPVIPQFPQNE 117

Query: 608 EKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           EKTLVYVLVKKPEEQP+IIIP  +    PSKPEVYF +    K
Sbjct: 118 EKTLVYVLVKKPEEQPEIIIPTPAP-TQPSKPEVYFIRYKTQK 159


>AE014134-1356|AAF52571.2|  197|Drosophila melanogaster CG14534-PA
           protein.
          Length = 197

 Score = 88.2 bits (209), Expect = 1e-17
 Identities = 48/103 (46%), Positives = 58/103 (56%), Gaps = 1/103 (0%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAWLHP-RNXXXXXXXXXXXXXXXXXXXXXXXXXNE 607
           P++ KH+YVHVPPPEP E + PR P ++ P +                          NE
Sbjct: 59  PVIHKHVYVHVPPPEP-EYQAPRKPLYVPPPQKHYKIVFIKAPSPPVPTAPVIPQFPQNE 117

Query: 608 EKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           EKTLVYVLVKKPEEQP+IIIP  +    PSKPEVYF +    K
Sbjct: 118 EKTLVYVLVKKPEEQPEIIIPTPAP-TQPSKPEVYFIRYKTQK 159


>BT028801-1|ABI34182.1|  286|Drosophila melanogaster LP21747p
           protein.
          Length = 286

 Score = 78.6 bits (185), Expect = 1e-14
 Identities = 47/102 (46%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQR-LPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEE 610
           LVQKHIYVHVPPPE  E R  P +P     +                          NEE
Sbjct: 130 LVQKHIYVHVPPPEQEEVRQRPNLPIG-QSQKHYKIIFIKAPSPPSYQAPVIPLQPQNEE 188

Query: 611 KTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           KTLVYVLVKKPE+Q DI+IP  +    PSKPEVYF +    K
Sbjct: 189 KTLVYVLVKKPEDQQDIVIPTPAP-TQPSKPEVYFIKYKTQK 229



 Score = 33.9 bits (74), Expect = 0.28
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>BT004476-1|AAO42640.1|  286|Drosophila melanogaster LP07342p
           protein.
          Length = 286

 Score = 78.6 bits (185), Expect = 1e-14
 Identities = 47/102 (46%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQR-LPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEE 610
           LVQKHIYVHVPPPE  E R  P +P     +                          NEE
Sbjct: 130 LVQKHIYVHVPPPEQEEVRQRPNLPIG-QSQKHYKIIFIKAPSPPSYQAPVIPLQPQNEE 188

Query: 611 KTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           KTLVYVLVKKPE+Q DI+IP  +    PSKPEVYF +    K
Sbjct: 189 KTLVYVLVKKPEDQQDIVIPTPAP-TQPSKPEVYFIKYKTQK 229



 Score = 33.9 bits (74), Expect = 0.28
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>AE014297-4048|AAF56656.1|  286|Drosophila melanogaster CG5812-PA
           protein.
          Length = 286

 Score = 78.6 bits (185), Expect = 1e-14
 Identities = 47/102 (46%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQR-LPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEE 610
           LVQKHIYVHVPPPE  E R  P +P     +                          NEE
Sbjct: 130 LVQKHIYVHVPPPEQEEVRQRPNLPIG-QSQKHYKIIFIKAPSPPSYQAPVIPLQPQNEE 188

Query: 611 KTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           KTLVYVLVKKPE+Q DI+IP  +    PSKPEVYF +    K
Sbjct: 189 KTLVYVLVKKPEDQQDIVIPTPAP-TQPSKPEVYFIKYKTQK 229



 Score = 33.9 bits (74), Expect = 0.28
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>AJ271041-1|CAB66004.1|  286|Drosophila melanogaster Gly-rich
           protein protein.
          Length = 286

 Score = 77.0 bits (181), Expect = 3e-14
 Identities = 46/102 (45%), Positives = 53/102 (51%), Gaps = 1/102 (0%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVE-QRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEE 610
           LVQKHIYVHVPPPE  E  + P +P     +                          NEE
Sbjct: 130 LVQKHIYVHVPPPEQEEVGQRPNLPIG-QSQKHYKIIFIKAPSPPSYQAPVIPLQPQNEE 188

Query: 611 KTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           KTLVYVLVKKPE+Q DI+IP  +    PSKPEVYF +    K
Sbjct: 189 KTLVYVLVKKPEDQQDIVIPTPAP-TQPSKPEVYFIKYKTQK 229



 Score = 33.9 bits (74), Expect = 0.28
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>AY071066-1|AAL48688.1|  198|Drosophila melanogaster RE14272p
           protein.
          Length = 198

 Score = 61.3 bits (142), Expect = 2e-09
 Identities = 37/94 (39%), Positives = 44/94 (46%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEK 613
           LV K++YVHVPP EP             P+                          +E K
Sbjct: 69  LVTKNVYVHVPPEEPEFYPASSPIQTAVPKKHYKIIFIKAPNPPTPVRQVLPPPVQDEHK 128

Query: 614 TLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           TLVYVLVKKPEEQ  +I+P +     PSKPEVYF
Sbjct: 129 TLVYVLVKKPEEQQPVILP-APEPTEPSKPEVYF 161



 Score = 32.7 bits (71), Expect = 0.64
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = +1

Query: 511 APPQKHYKIIFIKGPN 558
           A P+KHYKIIFIK PN
Sbjct: 95  AVPKKHYKIIFIKAPN 110


>AE013599-1351|AAF58614.1|  198|Drosophila melanogaster CG8986-PA
           protein.
          Length = 198

 Score = 61.3 bits (142), Expect = 2e-09
 Identities = 37/94 (39%), Positives = 44/94 (46%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEK 613
           LV K++YVHVPP EP             P+                          +E K
Sbjct: 69  LVTKNVYVHVPPEEPEFYPASSPIQTAVPKKHYKIIFIKAPNPPTPVRQVLPPPVQDEHK 128

Query: 614 TLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           TLVYVLVKKPEEQ  +I+P +     PSKPEVYF
Sbjct: 129 TLVYVLVKKPEEQQPVILP-APEPTEPSKPEVYF 161



 Score = 32.7 bits (71), Expect = 0.64
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = +1

Query: 511 APPQKHYKIIFIKGPN 558
           A P+KHYKIIFIK PN
Sbjct: 95  AVPKKHYKIIFIKAPN 110


>BT021279-1|AAX33427.1|  392|Drosophila melanogaster RE40185p
           protein.
          Length = 392

 Score = 59.7 bits (138), Expect = 5e-09
 Identities = 39/103 (37%), Positives = 49/103 (47%), Gaps = 3/103 (2%)
 Frame = +2

Query: 437 VQKHIYVHVPPPEPVEQRL--PRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXX-NE 607
           V KHIYVHVPP +  E+     R+     P+                           NE
Sbjct: 159 VHKHIYVHVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQNE 218

Query: 608 EKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           EKTL+YVL KKPE++ DI+IP +     PSKPEVYF +    K
Sbjct: 219 EKTLIYVLHKKPEQEQDIVIP-TPPPTKPSKPEVYFIKYKTKK 260



 Score = 31.5 bits (68), Expect = 1.5
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)
 Frame = +1

Query: 67  VSSKRISLVSSKHKMRAFVVL---ACVAMAYGRPEPPVGYSY 183
           +SSK   +  SK ++ +  V+   + VA   GRPEPP  YSY
Sbjct: 21  LSSKGFPITRSKMRVSSLFVVCVASLVATTLGRPEPPSPYSY 62



 Score = 31.1 bits (67), Expect = 1.9
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 514 PPQKHYKIIFIKGPNS 561
           P QKHYKI+FIK P++
Sbjct: 188 PKQKHYKIVFIKAPSA 203


>AE014297-4038|AAF56647.1|  360|Drosophila melanogaster CG14254-PA
           protein.
          Length = 360

 Score = 59.7 bits (138), Expect = 5e-09
 Identities = 39/103 (37%), Positives = 49/103 (47%), Gaps = 3/103 (2%)
 Frame = +2

Query: 437 VQKHIYVHVPPPEPVEQRL--PRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXX-NE 607
           V KHIYVHVPP +  E+     R+     P+                           NE
Sbjct: 127 VHKHIYVHVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQNE 186

Query: 608 EKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
           EKTL+YVL KKPE++ DI+IP +     PSKPEVYF +    K
Sbjct: 187 EKTLIYVLHKKPEQEQDIVIP-TPPPTKPSKPEVYFIKYKTKK 228



 Score = 31.1 bits (67), Expect = 1.9
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 514 PPQKHYKIIFIKGPNS 561
           P QKHYKI+FIK P++
Sbjct: 156 PKQKHYKIVFIKAPSA 171


>AY075518-1|AAL68326.1|  278|Drosophila melanogaster RE68367p
           protein.
          Length = 278

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 33/95 (34%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQRLPR-IPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEE 610
           LV K IYVHVPP E  E R P+ +     PR                           EE
Sbjct: 112 LVSKDIYVHVPPAEEPEDRYPQPVLPPAPPRKHYRIVFIKAPTTSVSKAALRIKQAPVEE 171

Query: 611 KTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           KT++YVL KKP+               PSKPEV+F
Sbjct: 172 KTIIYVLTKKPDPLDLQTAIEEIAPKQPSKPEVFF 206



 Score = 34.7 bits (76), Expect = 0.16
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +1

Query: 511 APPQKHYKIIFIKGPNSSHS 570
           APP+KHY+I+FIK P +S S
Sbjct: 139 APPRKHYRIVFIKAPTTSVS 158


>AE014297-28|AAF52158.1|  278|Drosophila melanogaster CG14643-PA
           protein.
          Length = 278

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 33/95 (34%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQRLPR-IPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEE 610
           LV K IYVHVPP E  E R P+ +     PR                           EE
Sbjct: 112 LVSKDIYVHVPPAEEPEDRYPQPVLPPAPPRKHYRIVFIKAPTTSVSKAALRIKQAPVEE 171

Query: 611 KTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           KT++YVL KKP+               PSKPEV+F
Sbjct: 172 KTIIYVLTKKPDPLDLQTAIEEIAPKQPSKPEVFF 206



 Score = 34.7 bits (76), Expect = 0.16
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +1

Query: 511 APPQKHYKIIFIKGPNSSHS 570
           APP+KHY+I+FIK P +S S
Sbjct: 139 APPRKHYRIVFIKAPTTSVS 158


>AE014297-30|AAF52156.1|  251|Drosophila melanogaster CG14640-PA
           protein.
          Length = 251

 Score = 35.9 bits (79), Expect = 0.068
 Identities = 26/94 (27%), Positives = 39/94 (41%)
 Frame = +2

Query: 434 LVQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEK 613
           +V K  ++H  P E  + +   I   +  RN                         NEEK
Sbjct: 78  IVSKRFFIHSAPEEAEDYKERHITVGVPKRNYNVVFIKSPQRNNRKTIKISPAA--NEEK 135

Query: 614 TLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYF 715
           T++YVL KK E   +  +   ++  S SKPEV+F
Sbjct: 136 TVIYVLSKKGESDLNAEVVEQAS--STSKPEVFF 167


>BT022947-1|AAY55363.1|  346|Drosophila melanogaster IP11207p
           protein.
          Length = 346

 Score = 35.5 bits (78), Expect = 0.090
 Identities = 25/100 (25%), Positives = 38/100 (38%)
 Frame = +2

Query: 437 VQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEKT 616
           + KH Y+H  P +  EQ++ R      P+                           EEKT
Sbjct: 147 INKHFYIHSAPEDHDEQQIVRYVNVGRPQKNYRVVFINAPTSTASKAKIIANVAPVEEKT 206

Query: 617 LVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
            +YVL KK     D+     +     +KPEV+F +   P+
Sbjct: 207 AIYVLSKK-SNALDVTAEVVTQRPVANKPEVFFVKYKTPQ 245


>AE014298-2469|AAN09419.1|  346|Drosophila melanogaster CG32571-PA
           protein.
          Length = 346

 Score = 35.5 bits (78), Expect = 0.090
 Identities = 25/100 (25%), Positives = 38/100 (38%)
 Frame = +2

Query: 437 VQKHIYVHVPPPEPVEQRLPRIPAWLHPRNXXXXXXXXXXXXXXXXXXXXXXXXXNEEKT 616
           + KH Y+H  P +  EQ++ R      P+                           EEKT
Sbjct: 147 INKHFYIHSAPEDHDEQQIVRYVNVGRPQKNYRVVFINAPTSTASKAKIIANVAPVEEKT 206

Query: 617 LVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPK 736
            +YVL KK     D+     +     +KPEV+F +   P+
Sbjct: 207 AIYVLSKK-SNALDVTAEVVTQRPVANKPEVFFVKYKTPQ 245


>AY061275-1|AAL28823.1|  354|Drosophila melanogaster LD19715p
           protein.
          Length = 354

 Score = 34.3 bits (75), Expect = 0.21
 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 3/41 (7%)
 Frame = +2

Query: 602 NEEKTLVYVLVKKP---EEQPDIIIPNSSTHFSPSKPEVYF 715
           NEEKT++YVL KKP   E Q  + +  S       KPEVYF
Sbjct: 197 NEEKTVIYVLSKKPDLTEIQQQLQVTQSEA--KVQKPEVYF 235


>AE014297-27|AAF52159.1|  354|Drosophila melanogaster CG14639-PA
           protein.
          Length = 354

 Score = 34.3 bits (75), Expect = 0.21
 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 3/41 (7%)
 Frame = +2

Query: 602 NEEKTLVYVLVKKP---EEQPDIIIPNSSTHFSPSKPEVYF 715
           NEEKT++YVL KKP   E Q  + +  S       KPEVYF
Sbjct: 197 NEEKTVIYVLSKKPDLTEIQQQLQVTQSEA--KVQKPEVYF 235


>BT001478-1|AAN71233.1|  308|Drosophila melanogaster LD21452p
           protein.
          Length = 308

 Score = 33.5 bits (73), Expect = 0.36
 Identities = 26/104 (25%), Positives = 40/104 (38%), Gaps = 2/104 (1%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAWLH-PRNXXXXXXXXXXXXXXXXXXXXXXXXXNE 607
           P+V K+ ++H  P E  ++    +      PRN                          +
Sbjct: 127 PIVTKNFFIHSAPEESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRAAALNLAKTLKQ 186

Query: 608 EKTLVYVLVKKPEEQP-DIIIPNSSTHFSPSKPEVYFHQISNPK 736
           EKT+VYVL KK         I  +  H   +KPEV+F +   P+
Sbjct: 187 EKTVVYVLAKKTTASDLQDAIAEAPQHI--NKPEVFFIKYRTPE 228


>AY118694-1|AAM50554.1|  360|Drosophila melanogaster AT18267p
           protein.
          Length = 360

 Score = 33.5 bits (73), Expect = 0.36
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPE--EQPDIIIPNSSTHFSPSKPEVYF 715
           EEKT++YVL KK    E  DI  P  +    PSKPEV+F
Sbjct: 201 EEKTVIYVLSKKDNQLEVNDIATPAPTV---PSKPEVFF 236



 Score = 31.5 bits (68), Expect = 1.5
 Identities = 11/26 (42%), Positives = 20/26 (76%)
 Frame = +1

Query: 493 SSYPCLAPPQKHYKIIFIKGPNSSHS 570
           S +  +  PQK+Y+++FIK P+SS++
Sbjct: 164 SKHLVIGRPQKNYRVVFIKAPSSSNA 189


>AE014298-2473|AAN09422.1|  388|Drosophila melanogaster CG32574-PA
           protein.
          Length = 388

 Score = 33.5 bits (73), Expect = 0.36
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPE--EQPDIIIPNSSTHFSPSKPEVYF 715
           EEKT++YVL KK    E  DI  P  +    PSKPEV+F
Sbjct: 229 EEKTVIYVLSKKDNQLEVNDIATPAPTV---PSKPEVFF 264



 Score = 31.5 bits (68), Expect = 1.5
 Identities = 11/26 (42%), Positives = 20/26 (76%)
 Frame = +1

Query: 493 SSYPCLAPPQKHYKIIFIKGPNSSHS 570
           S +  +  PQK+Y+++FIK P+SS++
Sbjct: 192 SKHLVIGRPQKNYRVVFIKAPSSSNA 217


>AE014297-2327|AAF55398.2|  308|Drosophila melanogaster CG4060-PA
           protein.
          Length = 308

 Score = 33.5 bits (73), Expect = 0.36
 Identities = 26/104 (25%), Positives = 40/104 (38%), Gaps = 2/104 (1%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAWLH-PRNXXXXXXXXXXXXXXXXXXXXXXXXXNE 607
           P+V K+ ++H  P E  ++    +      PRN                          +
Sbjct: 127 PIVTKNFFIHSAPEESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRAAALNLAKTLKQ 186

Query: 608 EKTLVYVLVKKPEEQP-DIIIPNSSTHFSPSKPEVYFHQISNPK 736
           EKT+VYVL KK         I  +  H   +KPEV+F +   P+
Sbjct: 187 EKTVVYVLAKKTTASDLQDAIAEAPQHI--NKPEVFFIKYRTPE 228


>BT014653-1|AAT27277.1|  247|Drosophila melanogaster RE02040p
           protein.
          Length = 247

 Score = 33.1 bits (72), Expect = 0.48
 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPE--EQPDIIIPNSSTHFSPSKPEVYF 715
           EEKT++YVL KK    +  DI  P  +    PSKPEV+F
Sbjct: 134 EEKTVIYVLSKKDNDVDASDIATPAPT---QPSKPEVFF 169


>AE014298-2470|AAN09420.1|  247|Drosophila melanogaster CG32570-PA
           protein.
          Length = 247

 Score = 33.1 bits (72), Expect = 0.48
 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPE--EQPDIIIPNSSTHFSPSKPEVYF 715
           EEKT++YVL KK    +  DI  P  +    PSKPEV+F
Sbjct: 134 EEKTVIYVLSKKDNDVDASDIATPAPT---QPSKPEVFF 169


>AE014298-2471|AAN09421.1|  223|Drosophila melanogaster CG32569-PA
           protein.
          Length = 223

 Score = 31.9 bits (69), Expect = 1.1
 Identities = 25/99 (25%), Positives = 38/99 (38%), Gaps = 4/99 (4%)
 Frame = +2

Query: 431 PLVQKHIYVHVPPPEPVEQRLPRIPAWL--HPRNXXXXXXXXXXXXXXXXXXXXXXXXXN 604
           P++ K  Y  + P E  E   PR    +   PR                           
Sbjct: 46  PIITKQFY-SISPAEDPEDLEPRTKHLVIGQPRRNYRVIFIRAPTGNSEHVKYTAELAPQ 104

Query: 605 EEKTLVYVLVKKPE--EQPDIIIPNSSTHFSPSKPEVYF 715
           EE+T++YVL +K +  E  DI+ P   +     KP+V+F
Sbjct: 105 EERTVIYVLTRKQQELEAADIMAPQQKSQVE-QKPDVFF 142


>X62591-1|CAA44476.1|  477|Drosophila melanogaster miniparamyosin
           protein.
          Length = 477

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPKGI 742
           +E+T+  VLV+  E+Q ++I+   +   S +K  +Y  Q+S  +G+
Sbjct: 371 KERTVKEVLVQCEEDQKNLILLQDALDKSTAKINIYRRQLSEQEGV 416


>X62590-1|CAA44475.1|  879|Drosophila melanogaster standard
           paramyosin protein.
          Length = 879

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPKGI 742
           +E+T+  VLV+  E+Q ++I+   +   S +K  +Y  Q+S  +G+
Sbjct: 773 KERTVKEVLVQCEEDQKNLILLQDALDKSTAKINIYRRQLSEQEGV 818


>X58722-1|CAA41557.1|  878|Drosophila melanogaster paramyosin
           protein.
          Length = 878

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPKGI 742
           +E+T+  VLV+  E+Q ++I+   +   S +K  +Y  Q+S  +G+
Sbjct: 772 KERTVKEVLVQCEEDQKNLILLQDALDKSTAKINIYRRQLSEQEGV 817


>BT016143-1|AAV37028.1| 1240|Drosophila melanogaster AT25839p
           protein.
          Length = 1240

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = -2

Query: 818 PPKSFRPKSLRPKSTAQSPRPIA 750
           PP+ F P+ ++P+  AQ PRP++
Sbjct: 845 PPQIFNPQPVKPEPLAQPPRPLS 867


>AY051540-1|AAK92964.1|  777|Drosophila melanogaster GH19061p
           protein.
          Length = 777

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = -2

Query: 818 PPKSFRPKSLRPKSTAQSPRPIA 750
           PP+ F P+ ++P+  AQ PRP++
Sbjct: 382 PPQIFNPQPVKPEPLAQPPRPLS 404


>AE014296-1516|AAN11995.1|  640|Drosophila melanogaster CG5939-PD,
           isoform D protein.
          Length = 640

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPKGI 742
           +E+T+  VLV+  E+Q ++I+   +   S +K  +Y  Q+S  +G+
Sbjct: 534 KERTVKEVLVQCEEDQKNLILLQDALDKSTAKINIYRRQLSEQEGV 579


>AE014296-1515|AAF50371.2|  640|Drosophila melanogaster CG5939-PC,
           isoform C protein.
          Length = 640

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPKGI 742
           +E+T+  VLV+  E+Q ++I+   +   S +K  +Y  Q+S  +G+
Sbjct: 534 KERTVKEVLVQCEEDQKNLILLQDALDKSTAKINIYRRQLSEQEGV 579


>AE014296-1514|AAN11994.1|  879|Drosophila melanogaster CG5939-PB,
           isoform B protein.
          Length = 879

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPKGI 742
           +E+T+  VLV+  E+Q ++I+   +   S +K  +Y  Q+S  +G+
Sbjct: 773 KERTVKEVLVQCEEDQKNLILLQDALDKSTAKINIYRRQLSEQEGV 818


>AE014296-1513|AAF50370.1|  879|Drosophila melanogaster CG5939-PA,
           isoform A protein.
          Length = 879

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +2

Query: 605 EEKTLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISNPKGI 742
           +E+T+  VLV+  E+Q ++I+   +   S +K  +Y  Q+S  +G+
Sbjct: 773 KERTVKEVLVQCEEDQKNLILLQDALDKSTAKINIYRRQLSEQEGV 818


>AE013599-727|AAF59033.1| 1240|Drosophila melanogaster CG8266-PA,
           isoform A protein.
          Length = 1240

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = -2

Query: 818 PPKSFRPKSLRPKSTAQSPRPIA 750
           PP+ F P+ ++P+  AQ PRP++
Sbjct: 845 PPQIFNPQPVKPEPLAQPPRPLS 867


>AE013599-726|AAM71085.1| 1241|Drosophila melanogaster CG8266-PB,
           isoform B protein.
          Length = 1241

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = -2

Query: 818 PPKSFRPKSLRPKSTAQSPRPIA 750
           PP+ F P+ ++P+  AQ PRP++
Sbjct: 846 PPQIFNPQPVKPEPLAQPPRPLS 868


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,965,354
Number of Sequences: 53049
Number of extensions: 599324
Number of successful extensions: 2595
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 2298
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2564
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3962724636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).