SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30019
         (719 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X67703-4|CAA47940.1|   68|Drosophila melanogaster Mst84Dd protein.     42   6e-04
BT029401-1|ABK57058.1|   96|Drosophila melanogaster IP02163p pro...    42   0.001
BT023344-1|AAY55760.1|   72|Drosophila melanogaster IP02161p pro...    42   0.001
AE014297-604|AAF54026.1|   72|Drosophila melanogaster CG17935-PA...    42   0.001
X67704-1|CAA47941.1|  334|Drosophila melanogaster sperm protein ...    35   0.13 
AY060667-1|AAL28215.1|  334|Drosophila melanogaster GH09231p pro...    35   0.13 
AE014297-4221|AAF56779.1|  334|Drosophila melanogaster CG11719-P...    35   0.13 
AE014297-2293|AAF55378.1|  623|Drosophila melanogaster CG4009-PA...    35   0.13 
AF273708-1|AAL35411.1|  118|Drosophila melanogaster PFTAIRE-inte...    33   0.39 
AE014297-475|AAF54113.3|  118|Drosophila melanogaster CG31483-PA...    33   0.39 
X67704-2|CAA47942.1|  265|Drosophila melanogaster sperm protein ...    33   0.52 
AY118617-1|AAM49986.1|  265|Drosophila melanogaster LP10995p pro...    33   0.52 
AE014297-4222|AAF56780.1|  265|Drosophila melanogaster CG18396-P...    33   0.52 
X67703-3|CAA47939.1|   55|Drosophila melanogaster Mst84Dc protein.     32   0.68 
BT003608-1|AAO39611.1|  377|Drosophila melanogaster GH19274p pro...    32   0.68 
BT003318-1|AAO25078.1|  517|Drosophila melanogaster AT26991p pro...    32   0.68 
BT001317-1|AAN71072.1|  517|Drosophila melanogaster AT15066p pro...    32   0.68 
AE014297-605|AAF54025.1|   55|Drosophila melanogaster CG17945-PA...    32   0.68 
AE014296-204|AAN11465.1|  517|Drosophila melanogaster CG9130-PB,...    32   0.68 
AE014296-203|AAN11464.1|  517|Drosophila melanogaster CG9130-PA,...    32   0.68 
AY061158-1|AAL28706.1|  180|Drosophila melanogaster LD12613p pro...    31   1.2  
AM294196-1|CAL26100.1|   60|Drosophila melanogaster CG17956 prot...    31   1.2  
AE014296-371|AAF47580.1|  180|Drosophila melanogaster CG1919-PA ...    31   1.2  
X67703-2|CAA47938.1|   74|Drosophila melanogaster Mst84Db protein.     31   2.1  
AE014134-1063|AAN10584.1|   58|Drosophila melanogaster CG31639-P...    31   2.1  
AE014134-1062|AAN10583.1|   58|Drosophila melanogaster CG31639-P...    31   2.1  
AE014297-606|AAF54024.1|   74|Drosophila melanogaster CG17934-PA...    30   2.8  
AE014296-3154|AAN11648.1|  154|Drosophila melanogaster CG32213-P...    30   2.8  
AE014296-3151|AAN11647.1|  154|Drosophila melanogaster CG32208-P...    30   2.8  
AE014296-3150|AAN11646.1|  141|Drosophila melanogaster CG32214-P...    30   2.8  
AE014134-1174|AAN10601.1|  287|Drosophila melanogaster CG17377-P...    30   2.8  
AE014296-1271|AAF50552.1|  275|Drosophila melanogaster CG8541-PA...    30   3.6  
Y00831-1|CAA68761.1|   56|Drosophila melanogaster structural spe...    29   4.8  
AM294198-1|CAL26102.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294197-1|CAL26101.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294195-1|CAL26099.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294194-1|CAL26098.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294193-1|CAL26097.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294192-1|CAL26096.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294191-1|CAL26095.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294190-1|CAL26094.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294189-1|CAL26093.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294188-1|CAL26092.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AM294187-1|CAL26091.1|   56|Drosophila melanogaster CG17956 prot...    29   4.8  
AE014297-1766|AAF54994.1|   56|Drosophila melanogaster CG17956-P...    29   4.8  
AE013599-399|AAM68891.2|  409|Drosophila melanogaster CG11112-PB...    29   4.8  
M27431-1|AAA28868.1| 1896|Drosophila melanogaster protein ( D.me...    29   6.4  
M19537-1|AAA28827.1|  408|Drosophila melanogaster RNA polymerase...    29   6.4  
AY089555-1|AAL90293.1| 1429|Drosophila melanogaster LD43558p pro...    29   6.4  
AE014298-1637|AAF48057.1| 1887|Drosophila melanogaster CG1554-PA...    29   6.4  

>X67703-4|CAA47940.1|   68|Drosophila melanogaster Mst84Dd protein.
          Length = 68

 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 18/40 (45%), Positives = 18/40 (45%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC 242
           C P       C   CC PC  P GPC  P  P C P GPC
Sbjct: 10  CGPCGPCCGPCCGPCCGPCCGPCGPCCGPCGPRCGPCGPC 49



 Score = 34.3 bits (75), Expect = 0.17
 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCCYPCSLPR-GPCSVPGRPSCLPRGPCSVPGAP 260
           CAP       C   CC PC  P  GPC  P  P C P GP   P  P
Sbjct: 3   CAPGGPCCGPC-GPCCGPCCGPCCGPCCGPCGPCCGPCGPRCGPCGP 48


>BT029401-1|ABK57058.1|   96|Drosophila melanogaster IP02163p
           protein.
          Length = 96

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/36 (50%), Positives = 18/36 (50%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC 242
           P   P C   CC PC  P GPC  P  P C P GPC
Sbjct: 43  PCCGPCC-GPCCGPCCGPCGPCCGPCGPRCGPCGPC 77



 Score = 35.5 bits (78), Expect = 0.073
 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 4/50 (8%)
 Frame = +3

Query: 123 CAP*-PASAP--RCQARCCYPCSLPR-GPCSVPGRPSCLPRGPCSVPGAP 260
           CAP  P   P   C   CC PC  P  GPC  P  P C P GP   P  P
Sbjct: 27  CAPGGPCCGPCGPCCGPCCGPCCGPCCGPCCGPCGPCCGPCGPRCGPCGP 76


>BT023344-1|AAY55760.1|   72|Drosophila melanogaster IP02161p
           protein.
          Length = 72

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/36 (50%), Positives = 18/36 (50%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC 242
           P   P C   CC PC  P GPC  P  P C P GPC
Sbjct: 19  PCCGPCC-GPCCGPCCGPCGPCCGPCGPRCGPCGPC 53



 Score = 35.5 bits (78), Expect = 0.073
 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 4/50 (8%)
 Frame = +3

Query: 123 CAP*-PASAP--RCQARCCYPCSLPR-GPCSVPGRPSCLPRGPCSVPGAP 260
           CAP  P   P   C   CC PC  P  GPC  P  P C P GP   P  P
Sbjct: 3   CAPGGPCCGPCGPCCGPCCGPCCGPCCGPCCGPCGPCCGPCGPRCGPCGP 52


>AE014297-604|AAF54026.1|   72|Drosophila melanogaster CG17935-PA
           protein.
          Length = 72

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/36 (50%), Positives = 18/36 (50%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC 242
           P   P C   CC PC  P GPC  P  P C P GPC
Sbjct: 19  PCCGPCC-GPCCGPCCGPCGPCCGPCGPRCGPCGPC 53



 Score = 35.5 bits (78), Expect = 0.073
 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 4/50 (8%)
 Frame = +3

Query: 123 CAP*-PASAP--RCQARCCYPCSLPR-GPCSVPGRPSCLPRGPCSVPGAP 260
           CAP  P   P   C   CC PC  P  GPC  P  P C P GP   P  P
Sbjct: 3   CAPGGPCCGPCGPCCGPCCGPCCGPCCGPCCGPCGPCCGPCGPRCGPCGP 52


>X67704-1|CAA47941.1|  334|Drosophila melanogaster sperm protein
           protein.
          Length = 334

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 21/53 (39%), Positives = 22/53 (41%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           C P       C  RC  PC    GPC  P  P C P GPC+VP       T P
Sbjct: 207 CGPCGPGCGPCGPRCG-PCG--PGPCG-PCGPRCGPGGPCAVPNCGPCGLTMP 255



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/38 (44%), Positives = 20/38 (52%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           C PC+ P GPC   G   C P GPC  P +P   + SP
Sbjct: 264 CGPCA-PCGPCGPLGNSPCGPCGPCG-PCSPPCPYESP 299


>AY060667-1|AAL28215.1|  334|Drosophila melanogaster GH09231p
           protein.
          Length = 334

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 21/53 (39%), Positives = 22/53 (41%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           C P       C  RC  PC    GPC  P  P C P GPC+VP       T P
Sbjct: 207 CGPCGPGCGPCGPRCG-PCG--PGPCG-PCGPRCGPGGPCAVPNCGPCGLTMP 255



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/38 (44%), Positives = 20/38 (52%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           C PC+ P GPC   G   C P GPC  P +P   + SP
Sbjct: 264 CGPCA-PCGPCGPLGNSPCGPCGPCG-PCSPPCPYESP 299


>AE014297-4221|AAF56779.1|  334|Drosophila melanogaster CG11719-PA
           protein.
          Length = 334

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 21/53 (39%), Positives = 22/53 (41%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           C P       C  RC  PC    GPC  P  P C P GPC+VP       T P
Sbjct: 207 CGPCGPGCGPCGPRCG-PCG--PGPCG-PCGPRCGPGGPCAVPNCGPCGLTMP 255



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/38 (44%), Positives = 20/38 (52%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           C PC+ P GPC   G   C P GPC  P +P   + SP
Sbjct: 264 CGPCA-PCGPCGPLGNSPCGPCGPCG-PCSPPCPYESP 299


>AE014297-2293|AAF55378.1|  623|Drosophila melanogaster CG4009-PA
           protein.
          Length = 623

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 3/56 (5%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVP-GAPVAYHTSPLRYSSAESVSSQNIV--RHDQPQ 344
           P+  C+ P  P CLP    ++P G P+AYHT       A SVS  + +  + ++PQ
Sbjct: 174 PQDCCAEPRHPRCLP---INLPRGGPIAYHTGKTCLHFARSVSDADAICPKVEEPQ 226


>AF273708-1|AAL35411.1|  118|Drosophila melanogaster
           PFTAIRE-interacting factor 2 protein.
          Length = 118

 Score = 33.1 bits (72), Expect = 0.39
 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCCYPCSLP-RGPCSVP-GRPSCLP-RGPCSVP 251
           C P      +C   CC PC  P   PC  P   P C P  GPC  P
Sbjct: 62  CTPCCTPCCKCCTPCCVPCCTPCCTPCCTPCCTPCCSPCCGPCCSP 107



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVP-GRPSCLP-RGPCSVP 251
           P   P C   CC PC     PC VP   P C P   PC  P
Sbjct: 56  PCCTPCCTP-CCTPCCKCCTPCCVPCCTPCCTPCCTPCCTP 95



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPR-GPCSVP-GRPSCLPRGPCSVP 251
           P   P C   CC PC  P   PC  P   P C P   C  P
Sbjct: 36  PCCGPCCSP-CCGPCCSPCCSPCCTPCCTPCCTPCCKCCTP 75



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 2/41 (4%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLP-RGPCSVPGRPSCLP-RGPCSVP 251
           P  +P C + CC PC  P   PC     P C+P   PC  P
Sbjct: 48  PCCSPCC-SPCCTPCCTPCCTPCCKCCTPCCVPCCTPCCTP 87



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%)
 Frame = +3

Query: 123 CAP*-PASAPRCQARCCYPCSLPRGPCSVP-GRPSCLP-RGPCSVP 251
           C+P  P     C   CC PC    GPC  P   P C P   PC  P
Sbjct: 18  CSPCCPPCCNDCCGSCCSPCC---GPCCSPCCGPCCSPCCSPCCTP 60



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLP-RGPCSVPGRPSCLP-RGPCSVP 251
           P   P C + CC PC  P   PC  P    C P   PC  P
Sbjct: 44  PCCGPCC-SPCCSPCCTPCCTPCCTPCCKCCTPCCVPCCTP 83


>AE014297-475|AAF54113.3|  118|Drosophila melanogaster CG31483-PA
           protein.
          Length = 118

 Score = 33.1 bits (72), Expect = 0.39
 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCCYPCSLP-RGPCSVP-GRPSCLP-RGPCSVP 251
           C P      +C   CC PC  P   PC  P   P C P  GPC  P
Sbjct: 62  CTPCCTPCCKCCTPCCVPCCTPCCTPCCTPCCTPCCSPCCGPCCSP 107



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPRGPCSVP-GRPSCLP-RGPCSVP 251
           P   P C   CC PC     PC VP   P C P   PC  P
Sbjct: 56  PCCTPCCTP-CCTPCCKCCTPCCVPCCTPCCTPCCTPCCTP 95



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLPR-GPCSVP-GRPSCLPRGPCSVP 251
           P   P C   CC PC  P   PC  P   P C P   C  P
Sbjct: 36  PCCGPCCSP-CCGPCCSPCCSPCCTPCCTPCCTPCCKCCTP 75



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 2/41 (4%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLP-RGPCSVPGRPSCLP-RGPCSVP 251
           P  +P C + CC PC  P   PC     P C+P   PC  P
Sbjct: 48  PCCSPCC-SPCCTPCCTPCCTPCCKCCTPCCVPCCTPCCTP 87



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%)
 Frame = +3

Query: 123 CAP*-PASAPRCQARCCYPCSLPRGPCSVP-GRPSCLP-RGPCSVP 251
           C+P  P     C   CC PC    GPC  P   P C P   PC  P
Sbjct: 18  CSPCCPPCCNDCCGSCCSPCC---GPCCSPCCGPCCSPCCSPCCTP 60



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%)
 Frame = +3

Query: 135 PASAPRCQARCCYPCSLP-RGPCSVPGRPSCLP-RGPCSVP 251
           P   P C + CC PC  P   PC  P    C P   PC  P
Sbjct: 44  PCCGPCC-SPCCSPCCTPCCTPCCTPCCKCCTPCCVPCCTP 83


>X67704-2|CAA47942.1|  265|Drosophila melanogaster sperm protein
           protein.
          Length = 265

 Score = 32.7 bits (71), Expect = 0.52
 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 8/52 (15%)
 Frame = +3

Query: 123 CAP*PASA----PRCQARC--CYPCSLPRGPCSV--PGRPSCLPRGPCSVPG 254
           C P P  +    P  + RC  C PC    GPC    P  P C P GPC   G
Sbjct: 186 CCPLPCFSTNQYPVAEGRCGPCGPCGPGCGPCGPCGPWGPGCGPCGPCGPCG 237



 Score = 31.1 bits (67), Expect = 1.6
 Identities = 15/29 (51%), Positives = 15/29 (51%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVPG 254
           C PC  P GPC  P  P C P GPC   G
Sbjct: 227 CGPCG-PCGPCG-PFGPGCGPCGPCGPCG 253



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
 Frame = +3

Query: 123 CAP*PASAPR-CQARCCYPCSLPR-GPCSVPGRPSCLPRGPCSVPGAP 260
           CAP     P  C +   YP +  R GPC  P  P C P GPC  P  P
Sbjct: 180 CAPGGPCCPLPCFSTNQYPVAEGRCGPCG-PCGPGCGPCGPCG-PWGP 225


>AY118617-1|AAM49986.1|  265|Drosophila melanogaster LP10995p
           protein.
          Length = 265

 Score = 32.7 bits (71), Expect = 0.52
 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 8/52 (15%)
 Frame = +3

Query: 123 CAP*PASA----PRCQARC--CYPCSLPRGPCSV--PGRPSCLPRGPCSVPG 254
           C P P  +    P  + RC  C PC    GPC    P  P C P GPC   G
Sbjct: 186 CCPLPCFSTNQYPVAEGRCGPCGPCGPGCGPCGPCGPWGPGCGPCGPCGPCG 237



 Score = 31.1 bits (67), Expect = 1.6
 Identities = 15/29 (51%), Positives = 15/29 (51%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVPG 254
           C PC  P GPC  P  P C P GPC   G
Sbjct: 227 CGPCG-PCGPCG-PFGPGCGPCGPCGPCG 253



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
 Frame = +3

Query: 123 CAP*PASAPR-CQARCCYPCSLPR-GPCSVPGRPSCLPRGPCSVPGAP 260
           CAP     P  C +   YP +  R GPC  P  P C P GPC  P  P
Sbjct: 180 CAPGGPCCPLPCFSTNQYPVAEGRCGPCG-PCGPGCGPCGPCG-PWGP 225


>AE014297-4222|AAF56780.1|  265|Drosophila melanogaster CG18396-PA
           protein.
          Length = 265

 Score = 32.7 bits (71), Expect = 0.52
 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 8/52 (15%)
 Frame = +3

Query: 123 CAP*PASA----PRCQARC--CYPCSLPRGPCSV--PGRPSCLPRGPCSVPG 254
           C P P  +    P  + RC  C PC    GPC    P  P C P GPC   G
Sbjct: 186 CCPLPCFSTNQYPVAEGRCGPCGPCGPGCGPCGPCGPWGPGCGPCGPCGPCG 237



 Score = 31.1 bits (67), Expect = 1.6
 Identities = 15/29 (51%), Positives = 15/29 (51%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVPG 254
           C PC  P GPC  P  P C P GPC   G
Sbjct: 227 CGPCG-PCGPCG-PFGPGCGPCGPCGPCG 253



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
 Frame = +3

Query: 123 CAP*PASAPR-CQARCCYPCSLPR-GPCSVPGRPSCLPRGPCSVPGAP 260
           CAP     P  C +   YP +  R GPC  P  P C P GPC  P  P
Sbjct: 180 CAPGGPCCPLPCFSTNQYPVAEGRCGPCG-PCGPGCGPCGPCG-PWGP 225


>X67703-3|CAA47939.1|   55|Drosophila melanogaster Mst84Dc protein.
          Length = 55

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 14/30 (46%), Positives = 14/30 (46%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPRGPC 242
           C   CC PC  P GP   P    C P GPC
Sbjct: 10  CGYYCCGPCCGPCGPRCGPCGSCCGPCGPC 39



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 15/36 (41%), Positives = 16/36 (44%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           C + C Y C    GPC  P  P C P G C  P  P
Sbjct: 6   CGSCCGYYCC---GPCCGPCGPRCGPCGSCCGPCGP 38


>BT003608-1|AAO39611.1|  377|Drosophila melanogaster GH19274p
           protein.
          Length = 377

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 9/47 (19%)
 Frame = +3

Query: 147 PRCQARCCYPCSL--PRGPC-------SVPGRPSCLPRGPCSVPGAP 260
           P+C   CC PC    P GPC       S P  PSC P  PC  P  P
Sbjct: 94  PKCPEPCCGPCGPCGPCGPCPPPPSCGSCPPPPSCGP--PCPPPCDP 138


>BT003318-1|AAO25078.1|  517|Drosophila melanogaster AT26991p
           protein.
          Length = 517

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 9/47 (19%)
 Frame = +3

Query: 147 PRCQARCCYPCSL--PRGPC-------SVPGRPSCLPRGPCSVPGAP 260
           P+C   CC PC    P GPC       S P  PSC P  PC  P  P
Sbjct: 234 PKCPEPCCGPCGPCGPCGPCPPPPSCGSCPPPPSCGP--PCPPPCDP 278


>BT001317-1|AAN71072.1|  517|Drosophila melanogaster AT15066p
           protein.
          Length = 517

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 9/47 (19%)
 Frame = +3

Query: 147 PRCQARCCYPCSL--PRGPC-------SVPGRPSCLPRGPCSVPGAP 260
           P+C   CC PC    P GPC       S P  PSC P  PC  P  P
Sbjct: 234 PKCPEPCCGPCGPCGPCGPCPPPPSCGSCPPPPSCGP--PCPPPCDP 278


>AE014297-605|AAF54025.1|   55|Drosophila melanogaster CG17945-PA
           protein.
          Length = 55

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 14/30 (46%), Positives = 14/30 (46%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPRGPC 242
           C   CC PC  P GP   P    C P GPC
Sbjct: 10  CGYYCCGPCCGPCGPRCGPCGSCCGPCGPC 39



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 15/36 (41%), Positives = 16/36 (44%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           C + C Y C    GPC  P  P C P G C  P  P
Sbjct: 6   CGSCCGYYCC---GPCCGPCGPRCGPCGSCCGPCGP 38


>AE014296-204|AAN11465.1|  517|Drosophila melanogaster CG9130-PB,
           isoform B protein.
          Length = 517

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 9/47 (19%)
 Frame = +3

Query: 147 PRCQARCCYPCSL--PRGPC-------SVPGRPSCLPRGPCSVPGAP 260
           P+C   CC PC    P GPC       S P  PSC P  PC  P  P
Sbjct: 234 PKCPEPCCGPCGPCGPCGPCPPPPSCGSCPPPPSCGP--PCPPPCDP 278


>AE014296-203|AAN11464.1|  517|Drosophila melanogaster CG9130-PA,
           isoform A protein.
          Length = 517

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 9/47 (19%)
 Frame = +3

Query: 147 PRCQARCCYPCSL--PRGPC-------SVPGRPSCLPRGPCSVPGAP 260
           P+C   CC PC    P GPC       S P  PSC P  PC  P  P
Sbjct: 234 PKCPEPCCGPCGPCGPCGPCPPPPSCGSCPPPPSCGP--PCPPPCDP 278


>AY061158-1|AAL28706.1|  180|Drosophila melanogaster LD12613p
           protein.
          Length = 180

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = +2

Query: 509 PKYEYNYSVADGHSG 553
           PKY YNY VAD H+G
Sbjct: 52  PKYHYNYGVADSHTG 66



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 19/42 (45%), Positives = 21/42 (50%)
 Frame = +1

Query: 586 GDVVKGSYSFHEADGLYQNC*STPAERTTAGFKRGSFHNTGP 711
           GDVVKGSYS  E DG  +    T  +    GF     H TGP
Sbjct: 77  GDVVKGSYSLVEPDGSVRTVEYTADDHN--GF-NAVVHKTGP 115


>AM294196-1|CAL26100.1|   60|Drosophila melanogaster CG17956
           protein.
          Length = 60

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVP-GRPSCLPRGPC 242
           CC PC    GPC  P   P C P GPC
Sbjct: 2   CCGPCGPCCGPCCGPCCGPCCGPCGPC 28



 Score = 31.1 bits (67), Expect = 1.6
 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%)
 Frame = +3

Query: 123 CAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C P       C   CC PC  P GPC     P   P   GPC   G
Sbjct: 3   CGPCGPCCGPCCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 48


>AE014296-371|AAF47580.1|  180|Drosophila melanogaster CG1919-PA
           protein.
          Length = 180

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = +2

Query: 509 PKYEYNYSVADGHSG 553
           PKY YNY VAD H+G
Sbjct: 52  PKYHYNYGVADSHTG 66



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 19/42 (45%), Positives = 21/42 (50%)
 Frame = +1

Query: 586 GDVVKGSYSFHEADGLYQNC*STPAERTTAGFKRGSFHNTGP 711
           GDVVKGSYS  E DG  +    T  +    GF     H TGP
Sbjct: 77  GDVVKGSYSLVEPDGSVRTVEYTADDHN--GF-NAVVHKTGP 115


>X67703-2|CAA47938.1|   74|Drosophila melanogaster Mst84Db protein.
          Length = 74

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%)
 Frame = +3

Query: 168 CYPCSLPRGPCSV--PGRPSCLPRGPCSVPGAP 260
           C PC  P GPC    P    C P G C  P  P
Sbjct: 12  CSPCGGPCGPCGPCGPCGSCCSPCGSCCAPWGP 44



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARC--CYPCSLPRGPCSVPGRPSCLPRGPCSVPG 254
           C   C  C PC  P G C  P    C P GPC   G
Sbjct: 15  CGGPCGPCGPCG-PCGSCCSPCGSCCAPWGPCGPCG 49


>AE014134-1063|AAN10584.1|   58|Drosophila melanogaster CG31639-PB,
           isoform B protein.
          Length = 58

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 13/28 (46%), Positives = 14/28 (50%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVP 251
           C PC+L  GP S  G   C P GP   P
Sbjct: 25  CSPCALSLGPYSCCGPSGCGPSGPACWP 52


>AE014134-1062|AAN10583.1|   58|Drosophila melanogaster CG31639-PA,
           isoform A protein.
          Length = 58

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 13/28 (46%), Positives = 14/28 (50%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRGPCSVP 251
           C PC+L  GP S  G   C P GP   P
Sbjct: 25  CSPCALSLGPYSCCGPSGCGPSGPACWP 52


>AE014297-606|AAF54024.1|   74|Drosophila melanogaster CG17934-PA
           protein.
          Length = 74

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%)
 Frame = +3

Query: 168 CYPCSLPRGPCSV--PGRPSCLPRGPCSVPGAP 260
           C PC  P GPC    P    C P G C  P  P
Sbjct: 12  CSPCGGPCGPCGPCGPCGSCCSPCGSCCAPCGP 44



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%)
 Frame = +3

Query: 123 CAP*PASAPRCQARC--CYPCSLPRGPCSVPGRPSC 224
           CAP     P C   C  C PC  P GPC  P RP C
Sbjct: 39  CAPCGPCGP-CGPCCGGCGPCG-PCGPCCGPCRPYC 72



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARC--CYPCSLPRGPCSVPGRPSCLPRGPCSVPG 254
           C   C  C PC  P G C  P    C P GPC   G
Sbjct: 15  CGGPCGPCGPCG-PCGSCCSPCGSCCAPCGPCGPCG 49


>AE014296-3154|AAN11648.1|  154|Drosophila melanogaster CG32213-PA
           protein.
          Length = 154

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%)
 Frame = +1

Query: 7   YNMFSKIVVLCALVA--VSKAGLLAAPVHYSPAEAVSSQSIV 126
           + MF   VV+ ALVA   +K GLL AP+ Y+   A S+ + V
Sbjct: 24  FTMFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAV 65


>AE014296-3151|AAN11647.1|  154|Drosophila melanogaster CG32208-PA
           protein.
          Length = 154

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%)
 Frame = +1

Query: 7   YNMFSKIVVLCALVA--VSKAGLLAAPVHYSPAEAVSSQSIV 126
           + MF   VV+ ALVA   +K GLL AP+ Y+   A S+ + V
Sbjct: 24  FTMFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAV 65


>AE014296-3150|AAN11646.1|  141|Drosophila melanogaster CG32214-PA
           protein.
          Length = 141

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%)
 Frame = +1

Query: 7   YNMFSKIVVLCALVA--VSKAGLLAAPVHYSPAEAVSSQSIV 126
           + MF   VV+ ALVA   +K GLL AP+ Y+   A S+ + V
Sbjct: 24  FTMFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAV 65


>AE014134-1174|AAN10601.1|  287|Drosophila melanogaster CG17377-PC,
           isoform C protein.
          Length = 287

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRPSCLPRG--PCSVPGAPVAYHTSPLRYSSA 299
           C PC     PC  P  P C      PC  P +P     SP+  SSA
Sbjct: 104 CGPCCCNVSPCCGPHSPPCCGSHSLPCCGPHSPPCGAPSPIPCSSA 149


>AE014296-1271|AAF50552.1|  275|Drosophila melanogaster CG8541-PA
           protein.
          Length = 275

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 4/42 (9%)
 Frame = +1

Query: 16  FSKIVVLCALVAVSKAGLLAAPVHYS--PAEAVSS--QSIVR 129
           F  ++ LCALVA + AGLLA+ V  +    +AV+S  Q++VR
Sbjct: 3   FRYLISLCALVACANAGLLASHVAIANPSVDAVASTQQNVVR 44


>Y00831-1|CAA68761.1|   56|Drosophila melanogaster structural sperm
           protein protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294198-1|CAL26102.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294197-1|CAL26101.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294195-1|CAL26099.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294194-1|CAL26098.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294193-1|CAL26097.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294192-1|CAL26096.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294191-1|CAL26095.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294190-1|CAL26094.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPWYGPNVCGPCYACG 44


>AM294189-1|CAL26093.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294188-1|CAL26092.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AM294187-1|CAL26091.1|   56|Drosophila melanogaster CG17956
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AE014297-1766|AAF54994.1|   56|Drosophila melanogaster CG17956-PA
           protein.
          Length = 56

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/26 (50%), Positives = 13/26 (50%)
 Frame = +3

Query: 165 CCYPCSLPRGPCSVPGRPSCLPRGPC 242
           CC PC    GPC     P C P GPC
Sbjct: 2   CCGPCGPCCGPCC---GPCCGPCGPC 24



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPRGPCSVPGRPSCLPR--GPCSVPG 254
           C   CC PC  P GPC     P   P   GPC   G
Sbjct: 9   CCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACG 44


>AE013599-399|AAM68891.2|  409|Drosophila melanogaster CG11112-PB,
           isoform B protein.
          Length = 409

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%)
 Frame = +3

Query: 153 CQARCCYPCSLPR--GPCSVPGRPSCLPRGPCSVPG 254
           CQ   CYPC  P     C VP  P C P  PC  PG
Sbjct: 300 CQPPYCYPCRSPHCDSKC-VP--PDCYP--PCKEPG 330


>M27431-1|AAA28868.1| 1896|Drosophila melanogaster protein (
            D.melanogaster RpII215gene encoding RNA polymerase II,
            largest subunit, completecds. ).
          Length = 1896

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 14/36 (38%), Positives = 15/36 (41%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
            P   P  P   P  PS  P  PC  P +P    TSP
Sbjct: 1685 PSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSP 1720



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 17/46 (36%), Positives = 19/46 (41%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVS 311
            P   P  PC  P  PS  P  P   P  P    TSP  YS++   S
Sbjct: 1699 PSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSP-NYSASPQYS 1743


>M19537-1|AAA28827.1|  408|Drosophila melanogaster RNA polymerase II
           largest subunit protein.
          Length = 408

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 14/36 (38%), Positives = 15/36 (41%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P   P  P   P  PS  P  PC  P +P    TSP
Sbjct: 204 PSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSP 239



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 17/46 (36%), Positives = 19/46 (41%)
 Frame = +3

Query: 174 PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVS 311
           P   P  PC  P  PS  P  P   P  P    TSP  YS++   S
Sbjct: 218 PSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSP-NYSASPQYS 262


>AY089555-1|AAL90293.1| 1429|Drosophila melanogaster LD43558p protein.
          Length = 1429

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 14/36 (38%), Positives = 15/36 (41%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
            P   P  P   P  PS  P  PC  P +P    TSP
Sbjct: 1225 PSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSP 1260



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 17/46 (36%), Positives = 19/46 (41%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVS 311
            P   P  PC  P  PS  P  P   P  P    TSP  YS++   S
Sbjct: 1239 PSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSP-NYSASPQYS 1283


>AE014298-1637|AAF48057.1| 1887|Drosophila melanogaster CG1554-PA
            protein.
          Length = 1887

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 14/36 (38%), Positives = 15/36 (41%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
            P   P  P   P  PS  P  PC  P +P    TSP
Sbjct: 1683 PSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSP 1718



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 17/46 (36%), Positives = 19/46 (41%)
 Frame = +3

Query: 174  PCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVS 311
            P   P  PC  P  PS  P  P   P  P    TSP  YS++   S
Sbjct: 1697 PSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSP-NYSASPQYS 1741


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,920,021
Number of Sequences: 53049
Number of extensions: 501240
Number of successful extensions: 1947
Number of sequences better than 10.0: 50
Number of HSP's better than 10.0 without gapping: 1624
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1869
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3211306956
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).