SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY051640-1|AAK93064.1|  205|Drosophila melanogaster GM13948p pro...   173   2e-43
AE014297-307|AAF51987.1|  205|Drosophila melanogaster CG1475-PB ...   173   2e-43
BT030161-1|ABN49300.1|  326|Drosophila melanogaster IP17722p pro...    29   4.2  
AY094938-1|AAM11291.1|  449|Drosophila melanogaster RH55021p pro...    29   5.6  
AE013599-1183|AAF58743.3|  449|Drosophila melanogaster CG12344-P...    29   5.6  
AE014296-2959|AAN11699.1|  419|Drosophila melanogaster CG32182-P...    29   7.4  

>AY051640-1|AAK93064.1|  205|Drosophila melanogaster GM13948p
           protein.
          Length = 205

 Score =  173 bits (420), Expect = 2e-43
 Identities = 82/163 (50%), Positives = 104/163 (63%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G +N+ +VIDGRGHLLGRLA+V+AK LL+G KV VVRCE++N+SG+F+RNK+K +++LRK
Sbjct: 3   GLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRK 62

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           RCNVNPARGPFHFRAPS+I +K V      K    +  L       G   P         
Sbjct: 63  RCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVV 122

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGK 491
                          C VGRLSHE+GW Y+DV++ LE KRK K
Sbjct: 123 PIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAK 165


>AE014297-307|AAF51987.1|  205|Drosophila melanogaster CG1475-PB
           protein.
          Length = 205

 Score =  173 bits (420), Expect = 2e-43
 Identities = 82/163 (50%), Positives = 104/163 (63%)
 Frame = +3

Query: 3   GFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRK 182
           G +N+ +VIDGRGHLLGRLA+V+AK LL+G KV VVRCE++N+SG+F+RNK+K +++LRK
Sbjct: 3   GLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRK 62

Query: 183 RCNVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXX 362
           RCNVNPARGPFHFRAPS+I +K V      K    +  L       G   P         
Sbjct: 63  RCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVV 122

Query: 363 XXXXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGK 491
                          C VGRLSHE+GW Y+DV++ LE KRK K
Sbjct: 123 PIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAK 165


>BT030161-1|ABN49300.1|  326|Drosophila melanogaster IP17722p
           protein.
          Length = 326

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = -2

Query: 431 MGQSAYMTVIYGQVLDRRHVEQQALQHVDGYQREEGTHH 315
           +G SAY+     Q L ++H++QQ LQ     Q++ G  H
Sbjct: 11  VGNSAYLNQHQQQHLQQQHLQQQHLQQQHLAQQQPGRQH 49


>AY094938-1|AAM11291.1|  449|Drosophila melanogaster RH55021p
           protein.
          Length = 449

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 14/37 (37%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
 Frame = -2

Query: 554 TFSPASLVILLSFFS-WHSLNSLALPLVFKLTNNITV 447
           TF+P+SLV++LS+FS W  L+++   +   +T  +T+
Sbjct: 253 TFAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTL 289


>AE013599-1183|AAF58743.3|  449|Drosophila melanogaster CG12344-PA
           protein.
          Length = 449

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 14/37 (37%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
 Frame = -2

Query: 554 TFSPASLVILLSFFS-WHSLNSLALPLVFKLTNNITV 447
           TF+P+SLV++LS+FS W  L+++   +   +T  +T+
Sbjct: 253 TFAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTL 289


>AE014296-2959|AAN11699.1|  419|Drosophila melanogaster CG32182-PA
           protein.
          Length = 419

 Score = 28.7 bits (61), Expect = 7.4
 Identities = 13/41 (31%), Positives = 18/41 (43%)
 Frame = -3

Query: 298 KSILATLCFVWDHASTVFHRILDGALKWKGPRAGFTLHLLR 176
           K +     F W    TV + + DG++KW   R      LLR
Sbjct: 278 KEVFRLQSFAWHSQLTVHYDVADGSVKWMPQRPQAVRSLLR 318


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,079,011
Number of Sequences: 53049
Number of extensions: 660056
Number of successful extensions: 1685
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1603
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1681
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2827453950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).