SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M36114-1|AAA28627.1|  651|Drosophila melanogaster protein ( D.me...   152   3e-37
L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock pro...   152   3e-37
BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p pro...   152   3e-37
AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p pro...   152   3e-37
AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF...   152   3e-37
AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE...   152   3e-37
AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD...   152   3e-37
AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC...   152   3e-37
AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB...   152   3e-37
AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA...   152   3e-37
L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock pro...   137   1e-32
BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p pro...   137   1e-32
AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD...   137   1e-32
AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC...   137   1e-32
AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA...   137   1e-32
BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p pro...   136   2e-32
J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1...   123   2e-28
BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p pro...   123   2e-28
BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p pro...   123   2e-28
BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p pro...   123   2e-28
AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb prot...   123   2e-28
AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock p...   123   2e-28
AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA...   123   2e-28
AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-P...   123   2e-28
AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA...   123   2e-28
AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-P...   123   2e-28
AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb prot...   122   3e-28
AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb prot...   122   3e-28
J01103-1|AAA28640.1|  643|Drosophila melanogaster protein ( D.me...   122   5e-28
BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p pro...   122   5e-28
AY118457-1|AAM49826.1|  319|Drosophila melanogaster AT29796p pro...   122   5e-28
AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock p...   122   5e-28
AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock p...   122   5e-28
AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock p...   122   5e-28
AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock p...   122   5e-28
AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-P...   122   5e-28
AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-P...   122   5e-28
AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock p...   121   7e-28
AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock p...   121   7e-28
AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock p...   120   1e-27
AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock p...   120   2e-27
AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock p...   119   3e-27
BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p pro...   116   2e-26
AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA...   116   2e-26
AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p pro...   115   6e-26
AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock p...   115   6e-26
AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA...   115   6e-26
BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p pro...   109   2e-24
AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD...   109   2e-24
AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC...   109   2e-24
AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB...   109   2e-24
AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA...   109   2e-24
L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock pro...   107   1e-23
L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock pro...    96   3e-20
AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p pro...    96   3e-20
AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA...    96   3e-20
V00214-1|CAA23496.1|  197|Drosophila melanogaster heat shock pro...    54   1e-07
BT021287-1|AAX33435.1|  826|Drosophila melanogaster RE31991p pro...    29   4.9  
AY118641-1|AAM50010.1|  678|Drosophila melanogaster SD02507p pro...    29   4.9  
AY051706-1|AAK93130.1|  735|Drosophila melanogaster LD24566p pro...    29   4.9  
AL021728-2|CAA16821.1|  735|Drosophila melanogaster EG:95B7.9 pr...    29   4.9  
AF022656-1|AAB87867.1|  971|Drosophila melanogaster beta-H spect...    29   4.9  
AE014298-1776|AAF48171.1| 1416|Drosophila melanogaster CG11146-P...    29   4.9  
AE014298-453|AAF45814.1|  735|Drosophila melanogaster CG2701-PA ...    29   4.9  
AE014296-651|AAF47766.1| 4097|Drosophila melanogaster CG12008-PA...    29   4.9  
AE014296-650|AAS64958.1| 4118|Drosophila melanogaster CG12008-PB...    29   4.9  
AE014296-649|AAS64957.1| 4207|Drosophila melanogaster CG12008-PC...    29   4.9  
AE014134-2952|AAF53685.2|  826|Drosophila melanogaster CG31790-P...    29   4.9  
AE014134-886|AAZ66447.1| 7744|Drosophila melanogaster CG33715-PB...    29   4.9  
AE014134-885|AAZ66446.1| 11707|Drosophila melanogaster CG33715-P...    29   4.9  
BT025953-1|ABG02197.1|  352|Drosophila melanogaster IP15285p pro...    29   6.5  
AY119169-1|AAM51029.1|  918|Drosophila melanogaster RH46576p pro...    29   6.5  
AE014298-2186|AAF48484.1|  410|Drosophila melanogaster CG15646-P...    29   6.5  
AE014298-1936|AAF48298.1|  918|Drosophila melanogaster CG12176-P...    29   6.5  
AE013599-660|AAF59081.2| 1264|Drosophila melanogaster CG30361-PA...    29   6.5  
M94375-1|AAA28551.1| 1680|Drosophila melanogaster furin2 protein.      28   8.6  
L33831-1|AAA69860.1| 1679|Drosophila melanogaster Dfurin2 protein.     28   8.6  
BT021414-1|AAX33562.1| 1061|Drosophila melanogaster LD05524p pro...    28   8.6  
AY070553-1|AAL48024.1| 1376|Drosophila melanogaster LD30182p pro...    28   8.6  
AE014298-2387|AAS65387.1| 1679|Drosophila melanogaster CG18734-P...    28   8.6  
AE014298-2386|AAN09402.1| 1679|Drosophila melanogaster CG18734-P...    28   8.6  
AE014298-2385|AAN09401.1| 1679|Drosophila melanogaster CG18734-P...    28   8.6  
AE014298-2384|AAN09400.1| 1679|Drosophila melanogaster CG18734-P...    28   8.6  
AE014298-2383|AAN09399.1| 1682|Drosophila melanogaster CG18734-P...    28   8.6  
AE014298-2382|AAF48599.2| 1682|Drosophila melanogaster CG18734-P...    28   8.6  
AE014298-2381|AAF48598.2| 1682|Drosophila melanogaster CG18734-P...    28   8.6  
AE014297-519|AAF54083.2|  586|Drosophila melanogaster CG2189-PA ...    28   8.6  
AE001572-6|AAD19796.1|  586|Drosophila melanogaster homeodomain ...    28   8.6  

>M36114-1|AAA28627.1|  651|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 4 (hsc4) gene, exon 2.
           ).
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p
           protein.
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p
           protein.
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF,
           isoform F protein.
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE,
           isoform E protein.
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD,
           isoform D protein.
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC,
           isoform C protein.
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB,
           isoform B protein.
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA,
           isoform A protein.
          Length = 651

 Score =  152 bits (369), Expect = 3e-37
 Identities = 80/142 (56%), Positives = 100/142 (70%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +E+STNKEN+  +   K    ++     +           +QKETI  +  +     +  
Sbjct: 491 LERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT++++ LK KI  +SD+ TI
Sbjct: 550 KATLDEDNLKTKI-SDSDRTTI 570


>L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 641

 Score =  137 bits (332), Expect = 1e-32
 Identities = 76/164 (46%), Positives = 105/164 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGVLIQVFEGERAMT+DNN LGKFEL+ IPPAPRGVPQ+EVTFDIDANGILNV+A
Sbjct: 431 YADNQPGVLIQVFEGERAMTRDNNSLGKFELSAIPPAPRGVPQVEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +EKST KENR  +   K    ++     +    +      +Q++ I  +  +        
Sbjct: 491 LEKSTGKENRITITNDKGRLSKEDIERMVNDAEAYRQADEQQRDRINAKNQLESYCFQL- 549

Query: 407 SATMEDEKLKEKILLNSDKQTIPRTSATSTHSSGWDFQSRLAEQ 538
            +T++DE L  +    +D++TI +    S+ +  W   ++LAE+
Sbjct: 550 RSTLDDEHLSSR-FSPADRETIQQ---RSSETIAWLDANQLAER 589


>BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p
           protein.
          Length = 555

 Score =  137 bits (332), Expect = 1e-32
 Identities = 76/164 (46%), Positives = 105/164 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGVLIQVFEGERAMT+DNN LGKFEL+ IPPAPRGVPQ+EVTFDIDANGILNV+A
Sbjct: 345 YADNQPGVLIQVFEGERAMTRDNNSLGKFELSAIPPAPRGVPQVEVTFDIDANGILNVTA 404

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +EKST KENR  +   K    ++     +    +      +Q++ I  +  +        
Sbjct: 405 LEKSTGKENRITITNDKGRLSKEDIERMVNDAEAYRQADEQQRDRINAKNQLESYCFQL- 463

Query: 407 SATMEDEKLKEKILLNSDKQTIPRTSATSTHSSGWDFQSRLAEQ 538
            +T++DE L  +    +D++TI +    S+ +  W   ++LAE+
Sbjct: 464 RSTLDDEHLSSR-FSPADRETIQQ---RSSETIAWLDANQLAER 503


>AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD,
           isoform D protein.
          Length = 555

 Score =  137 bits (332), Expect = 1e-32
 Identities = 76/164 (46%), Positives = 105/164 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGVLIQVFEGERAMT+DNN LGKFEL+ IPPAPRGVPQ+EVTFDIDANGILNV+A
Sbjct: 345 YADNQPGVLIQVFEGERAMTRDNNSLGKFELSAIPPAPRGVPQVEVTFDIDANGILNVTA 404

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +EKST KENR  +   K    ++     +    +      +Q++ I  +  +        
Sbjct: 405 LEKSTGKENRITITNDKGRLSKEDIERMVNDAEAYRQADEQQRDRINAKNQLESYCFQL- 463

Query: 407 SATMEDEKLKEKILLNSDKQTIPRTSATSTHSSGWDFQSRLAEQ 538
            +T++DE L  +    +D++TI +    S+ +  W   ++LAE+
Sbjct: 464 RSTLDDEHLSSR-FSPADRETIQQ---RSSETIAWLDANQLAER 503


>AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC,
           isoform C protein.
          Length = 555

 Score =  137 bits (332), Expect = 1e-32
 Identities = 76/164 (46%), Positives = 105/164 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGVLIQVFEGERAMT+DNN LGKFEL+ IPPAPRGVPQ+EVTFDIDANGILNV+A
Sbjct: 345 YADNQPGVLIQVFEGERAMTRDNNSLGKFELSAIPPAPRGVPQVEVTFDIDANGILNVTA 404

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +EKST KENR  +   K    ++     +    +      +Q++ I  +  +        
Sbjct: 405 LEKSTGKENRITITNDKGRLSKEDIERMVNDAEAYRQADEQQRDRINAKNQLESYCFQL- 463

Query: 407 SATMEDEKLKEKILLNSDKQTIPRTSATSTHSSGWDFQSRLAEQ 538
            +T++DE L  +    +D++TI +    S+ +  W   ++LAE+
Sbjct: 464 RSTLDDEHLSSR-FSPADRETIQQ---RSSETIAWLDANQLAER 503


>AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA,
           isoform A protein.
          Length = 641

 Score =  137 bits (332), Expect = 1e-32
 Identities = 76/164 (46%), Positives = 105/164 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGVLIQVFEGERAMT+DNN LGKFEL+ IPPAPRGVPQ+EVTFDIDANGILNV+A
Sbjct: 431 YADNQPGVLIQVFEGERAMTRDNNSLGKFELSAIPPAPRGVPQVEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +EKST KENR  +   K    ++     +    +      +Q++ I  +  +        
Sbjct: 491 LEKSTGKENRITITNDKGRLSKEDIERMVNDAEAYRQADEQQRDRINAKNQLESYCFQL- 549

Query: 407 SATMEDEKLKEKILLNSDKQTIPRTSATSTHSSGWDFQSRLAEQ 538
            +T++DE L  +    +D++TI +    S+ +  W   ++LAE+
Sbjct: 550 RSTLDDEHLSSR-FSPADRETIQQ---RSSETIAWLDANQLAER 589


>BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p
           protein.
          Length = 680

 Score =  136 bits (329), Expect = 2e-32
 Identities = 76/164 (46%), Positives = 104/164 (63%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGVLIQVFEGERAMT+DNN LGKFEL+ IPPAPRGVPQ+EVTFDIDANGILNV+A
Sbjct: 470 YADNQPGVLIQVFEGERAMTRDNNSLGKFELSAIPPAPRGVPQVEVTFDIDANGILNVTA 529

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +EKST KENR  +   K    ++     +           +Q++ I  +  +        
Sbjct: 530 LEKSTGKENRITITNDKGRLSKEDIERMVNDAEVYRQADEQQRDRINAKNQLESYCFQL- 588

Query: 407 SATMEDEKLKEKILLNSDKQTIPRTSATSTHSSGWDFQSRLAEQ 538
            +T++DE L  +    +D++TI +    S+ +  W   ++LAE+
Sbjct: 589 RSTLDDEHLSSR-FSPADRETIQQ---RSSETIAWLDANQLAER 628


>J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1
           protein protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p
           protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p
           protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p
           protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 23/35 (65%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+R+VNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRIVNEAEKYVDEDEK 529


>AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 23/35 (65%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+R+VNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRIVNEAEKYVDEDEK 529


>AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA
           protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-PA
           protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA
           protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-PA
           protein.
          Length = 641

 Score =  123 bits (296), Expect = 2e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  122 bits (295), Expect = 3e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVPIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  122 bits (295), Expect = 3e-28
 Identities = 58/77 (75%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVPIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>J01103-1|AAA28640.1|  643|Drosophila melanogaster protein (
           D.melanogaster heatshock protein 70 genes, locus 87A7,
           seg. 2. (partial proximalgene, spacer region and
           complete distal gene). ).
          Length = 643

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 430 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 489

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 490 KEMSTGKAKNITIKNDK 506



 Score = 54.8 bits (126), Expect = 9e-08
 Identities = 24/37 (64%), Positives = 31/37 (83%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K +
Sbjct: 496 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEKRR 532


>BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p
           protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AY118457-1|AAM49826.1|  319|Drosophila melanogaster AT29796p
           protein.
          Length = 319

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 106 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 165

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 166 KEMSTGKAKNITIKNDK 182



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 172 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 206


>AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 REMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 641

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-PA
           protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-PA
           protein.
          Length = 642

 Score =  122 bits (293), Expect = 5e-28
 Identities = 57/77 (74%), Positives = 63/77 (81%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  121 bits (292), Expect = 7e-28
 Identities = 58/77 (75%), Positives = 62/77 (80%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFYLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  121 bits (292), Expect = 7e-28
 Identities = 58/77 (75%), Positives = 62/77 (80%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFYLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  120 bits (290), Expect = 1e-27
 Identities = 57/77 (74%), Positives = 62/77 (80%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEV FD+DANGILNVSA
Sbjct: 429 YSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVIFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  120 bits (288), Expect = 2e-27
 Identities = 57/77 (74%), Positives = 62/77 (80%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVSEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTK 277
            E ST K     +   K
Sbjct: 489 KEMSTGKAKNITIKNDK 505



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 495 KAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  119 bits (287), Expect = 3e-27
 Identities = 55/65 (84%), Positives = 60/65 (92%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGV IQV+EGERAMTKDNN LG F+L+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSA 488

Query: 227 IEKST 241
            E ST
Sbjct: 489 KEMST 493



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/33 (72%), Positives = 29/33 (87%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + ITI NDKGRLS+ EI+RMVNEAEKY +ED+K
Sbjct: 497 KNITIKNDKGRLSQAEIDRMVNEAEKYADEDEK 529


>BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p
           protein.
          Length = 633

 Score =  116 bits (280), Expect = 2e-26
 Identities = 58/109 (53%), Positives = 71/109 (65%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ  V IQV+EGERAMTKDNNLLG F LTGIPPAPRGVPQIEV FD++A+GILNV+A
Sbjct: 432 YSDNQNAVTIQVYEGERAMTKDNNLLGTFNLTGIPPAPRGVPQIEVAFDLNADGILNVNA 491

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQ 373
            + ST K  +  +   K    +      L      +    RQ+E +Q +
Sbjct: 492 KDNSTGKSEKITISNDKGRLSKAEIDRMLSEAEKYKVEDDRQRERVQSK 540


>AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA
           protein.
          Length = 633

 Score =  116 bits (280), Expect = 2e-26
 Identities = 58/109 (53%), Positives = 71/109 (65%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ  V IQV+EGERAMTKDNNLLG F LTGIPPAPRGVPQIEV FD++A+GILNV+A
Sbjct: 432 YSDNQNAVTIQVYEGERAMTKDNNLLGTFNLTGIPPAPRGVPQIEVAFDLNADGILNVNA 491

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQ 373
            + ST K  +  +   K    +      L      +    RQ+E +Q +
Sbjct: 492 KDNSTGKSEKITISNDKGRLSKAEIDRMLSEAEKYKVEDDRQRERVQSK 540


>AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p
           protein.
          Length = 635

 Score =  115 bits (276), Expect = 6e-26
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQP V IQVFEGERA+TKDNN+LG F+LTG+PPAPRGVP+I+VTFD+DANGILNV+A
Sbjct: 429 YADNQPAVTIQVFEGERALTKDNNVLGTFDLTGVPPAPRGVPKIDVTFDLDANGILNVTA 488

Query: 227 IEKST-NKEN 253
            E+ T N +N
Sbjct: 489 KEQGTGNAKN 498



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/33 (60%), Positives = 28/33 (84%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + ITI NDKGRLS+ +I+RM++EAEKY  ED++
Sbjct: 497 KNITIKNDKGRLSQADIDRMLSEAEKYAEEDER 529


>AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock
           protein 68 protein.
          Length = 635

 Score =  115 bits (276), Expect = 6e-26
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQP V IQVFEGERA+TKDNN+LG F+LTG+PPAPRGVP+I+VTFD+DANGILNV+A
Sbjct: 429 YADNQPAVTIQVFEGERALTKDNNVLGTFDLTGVPPAPRGVPKIDVTFDLDANGILNVTA 488

Query: 227 IEKST-NKEN 253
            E+ T N +N
Sbjct: 489 KEQGTGNAKN 498



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/33 (60%), Positives = 28/33 (84%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + ITI NDKGRLS+ +I+RM++EAEKY  ED++
Sbjct: 497 KNITIKNDKGRLSQADIDRMLSEAEKYAEEDER 529


>AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA
           protein.
          Length = 635

 Score =  115 bits (276), Expect = 6e-26
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQP V IQVFEGERA+TKDNN+LG F+LTG+PPAPRGVP+I+VTFD+DANGILNV+A
Sbjct: 429 YADNQPAVTIQVFEGERALTKDNNVLGTFDLTGVPPAPRGVPKIDVTFDLDANGILNVTA 488

Query: 227 IEKST-NKEN 253
            E+ T N +N
Sbjct: 489 KEQGTGNAKN 498



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/33 (60%), Positives = 28/33 (84%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348
           + ITI NDKGRLS+ +I+RM++EAEKY  ED++
Sbjct: 497 KNITIKNDKGRLSQADIDRMLSEAEKYAEEDER 529


>BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p
           protein.
          Length = 655

 Score =  109 bits (263), Expect = 2e-24
 Identities = 53/68 (77%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQ  V IQV+EGER MTKDN+LLGKF+LTGIPPAPRG+PQIEV+F+IDANGIL VSA 
Sbjct: 454 SDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAE 513

Query: 230 EKST-NKE 250
           +K T NKE
Sbjct: 514 DKGTGNKE 521



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/35 (54%), Positives = 28/35 (80%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           E+I ITND+ RL+ E+I+RM+ +AEK+ +ED K K
Sbjct: 521 EKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLK 555


>AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD,
           isoform D protein.
          Length = 656

 Score =  109 bits (263), Expect = 2e-24
 Identities = 53/68 (77%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQ  V IQV+EGER MTKDN+LLGKF+LTGIPPAPRG+PQIEV+F+IDANGIL VSA 
Sbjct: 455 SDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAE 514

Query: 230 EKST-NKE 250
           +K T NKE
Sbjct: 515 DKGTGNKE 522



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/35 (54%), Positives = 28/35 (80%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           E+I ITND+ RL+ E+I+RM+ +AEK+ +ED K K
Sbjct: 522 EKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLK 556


>AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC,
           isoform C protein.
          Length = 656

 Score =  109 bits (263), Expect = 2e-24
 Identities = 53/68 (77%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQ  V IQV+EGER MTKDN+LLGKF+LTGIPPAPRG+PQIEV+F+IDANGIL VSA 
Sbjct: 455 SDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAE 514

Query: 230 EKST-NKE 250
           +K T NKE
Sbjct: 515 DKGTGNKE 522



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/35 (54%), Positives = 28/35 (80%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           E+I ITND+ RL+ E+I+RM+ +AEK+ +ED K K
Sbjct: 522 EKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLK 556


>AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB,
           isoform B protein.
          Length = 656

 Score =  109 bits (263), Expect = 2e-24
 Identities = 53/68 (77%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQ  V IQV+EGER MTKDN+LLGKF+LTGIPPAPRG+PQIEV+F+IDANGIL VSA 
Sbjct: 455 SDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAE 514

Query: 230 EKST-NKE 250
           +K T NKE
Sbjct: 515 DKGTGNKE 522



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/35 (54%), Positives = 28/35 (80%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           E+I ITND+ RL+ E+I+RM+ +AEK+ +ED K K
Sbjct: 522 EKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLK 556


>AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA,
           isoform A protein.
          Length = 656

 Score =  109 bits (263), Expect = 2e-24
 Identities = 53/68 (77%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQ  V IQV+EGER MTKDN+LLGKF+LTGIPPAPRG+PQIEV+F+IDANGIL VSA 
Sbjct: 455 SDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAE 514

Query: 230 EKST-NKE 250
           +K T NKE
Sbjct: 515 DKGTGNKE 522



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/35 (54%), Positives = 28/35 (80%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           E+I ITND+ RL+ E+I+RM+ +AEK+ +ED K K
Sbjct: 522 EKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLK 556


>L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock
           protein cognate 72 protein.
          Length = 656

 Score =  107 bits (257), Expect = 1e-23
 Identities = 52/68 (76%), Positives = 59/68 (86%), Gaps = 1/68 (1%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQ  V IQV+EGER MTKDN+LLGKF+LTGIPPAPRG+PQIEV+F+IDAN IL VSA 
Sbjct: 455 SDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANAILTVSAE 514

Query: 230 EKST-NKE 250
           +K T NKE
Sbjct: 515 DKGTGNKE 522



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/35 (54%), Positives = 28/35 (80%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           E+I ITND+ RL+ E+I+RM+ +AEK+ +ED K K
Sbjct: 522 EKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLK 556


>L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock
           protein cognate 71 protein.
          Length = 687

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 46/69 (66%), Positives = 52/69 (75%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SD Q  V I+V +GER M  DN LLG F L GIPPAPRGVPQIEV FDIDANGI++VSA 
Sbjct: 476 SDGQTQVEIKVHQGEREMANDNKLLGSFTLVGIPPAPRGVPQIEVVFDIDANGIVHVSAK 535

Query: 230 EKSTNKENR 256
           +K T KE +
Sbjct: 536 DKGTGKEQQ 544



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK+EIE M+ +AE+Y   D + +
Sbjct: 542 EQQIVIQSSGGLSKDEIENMIKKAEEYATADKQKR 576


>AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p
           protein.
          Length = 686

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 46/69 (66%), Positives = 52/69 (75%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SD Q  V I+V +GER M  DN LLG F L GIPPAPRGVPQIEV FDIDANGI++VSA 
Sbjct: 476 SDGQTQVEIKVHQGEREMANDNKLLGSFTLVGIPPAPRGVPQIEVVFDIDANGIVHVSAK 535

Query: 230 EKSTNKENR 256
           +K T KE +
Sbjct: 536 DKGTGKEQQ 544



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK+EIE M+ +AE+Y   D + +
Sbjct: 542 EQQIVIQSSGGLSKDEIENMIKKAEEYATADKQKR 576


>AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA
           protein.
          Length = 686

 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 46/69 (66%), Positives = 52/69 (75%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SD Q  V I+V +GER M  DN LLG F L GIPPAPRGVPQIEV FDIDANGI++VSA 
Sbjct: 476 SDGQTQVEIKVHQGEREMANDNKLLGSFTLVGIPPAPRGVPQIEVVFDIDANGIVHVSAK 535

Query: 230 EKSTNKENR 256
           +K T KE +
Sbjct: 536 DKGTGKEQQ 544



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK+EIE M+ +AE+Y   D + +
Sbjct: 542 EQQIVIQSSGGLSKDEIENMIKKAEEYATADKQKR 576


>V00214-1|CAA23496.1|  197|Drosophila melanogaster heat shock
           protein 70 protein.
          Length = 197

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 33/86 (38%), Positives = 48/86 (55%)
 Frame = +1

Query: 97  CYDQR*QLAR*IRADRDPTGAAWRASN*GHLRHRCQRYPQRFRYREVHQQGEQITITNDK 276
           C D+  Q    +R+ R  T     A +  +LR   Q  P+R R  + H QG++      +
Sbjct: 1   CDDEGQQCIGHLRSVRHSTCTKGCAPDRSYLRLGRQWNPERQRQGDEHGQGQEHHDQERQ 60

Query: 277 GRLSKEEIERMVNEAEKYRNEDDKAK 354
           G LS+ EI+RMVNEAEKY +ED+K +
Sbjct: 61  GTLSQAEIDRMVNEAEKYADEDEKRR 86


>BT021287-1|AAX33435.1|  826|Drosophila melanogaster RE31991p
           protein.
          Length = 826

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = +1

Query: 169 ASN*GH-LRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDD 345
           A N  H L  RC++Y      R++  Q +++T +   G   KEE+    +   + +N  D
Sbjct: 245 AGNHNHELEGRCRQYE-----RDLQIQRDRLTESEINGEKLKEELRGFESRCHRLQNNLD 299

Query: 346 KAKGD 360
           + +GD
Sbjct: 300 RTQGD 304


>AY118641-1|AAM50010.1|  678|Drosophila melanogaster SD02507p
           protein.
          Length = 678

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = +1

Query: 169 ASN*GH-LRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDD 345
           A N  H L  RC++Y      R++  Q +++T +   G   KEE+    +   + +N  D
Sbjct: 97  AGNHNHELEGRCRQYE-----RDLQIQRDRLTESEINGEKLKEELRGFESRCHRLQNNLD 151

Query: 346 KAKGD 360
           + +GD
Sbjct: 152 RTQGD 156


>AY051706-1|AAK93130.1|  735|Drosophila melanogaster LD24566p
           protein.
          Length = 735

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH--PGPRMHWN 387
           E   +G+   ++  +GRL +       N  ++  N+D+++ G H  P P M  N
Sbjct: 601 EAQNEGQAPPVSLLRGRLQEAASSSAYNAQDELENDDEESSGGHSDPEPSMRTN 654


>AL021728-2|CAA16821.1|  735|Drosophila melanogaster EG:95B7.9
           protein.
          Length = 735

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH--PGPRMHWN 387
           E   +G+   ++  +GRL +       N  ++  N+D+++ G H  P P M  N
Sbjct: 601 EAQNEGQAPPVSLLRGRLQEAASSSAYNAQDELENDDEESSGGHSDPEPSMRTN 654


>AF022656-1|AAB87867.1|  971|Drosophila melanogaster beta-H spectrin
           protein.
          Length = 971

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 16/61 (26%), Positives = 32/61 (52%)
 Frame = -2

Query: 196 DVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGGECLSLFSG 17
           ++E  L  R+   R  + G+   +   ++  H T+ L+ LD YSG+V  +G  C ++ + 
Sbjct: 92  EIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELE-LDTYSGIVTEMGHSCAAMVAA 150

Query: 16  D 14
           +
Sbjct: 151 N 151


>AE014298-1776|AAF48171.1| 1416|Drosophila melanogaster CG11146-PA
           protein.
          Length = 1416

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 15/67 (22%), Positives = 32/67 (47%)
 Frame = +1

Query: 160 AWRASN*GHLRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNE 339
           A + S  GH RH+ Q+  Q+   +++ QQ +Q   T    +  ++  +++      Y N 
Sbjct: 184 AKKRSTTGHKRHQQQQQQQQPHQQQLQQQQQQTLPTPRSAQQQQQLQQKLQQRHSTYNNN 243

Query: 340 DDKAKGD 360
           +  ++ D
Sbjct: 244 NGNSRKD 250


>AE014298-453|AAF45814.1|  735|Drosophila melanogaster CG2701-PA
           protein.
          Length = 735

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH--PGPRMHWN 387
           E   +G+   ++  +GRL +       N  ++  N+D+++ G H  P P M  N
Sbjct: 601 EAQNEGQAPPVSLLRGRLQEAASSSAYNAQDELENDDEESSGGHSDPEPSMRTN 654


>AE014296-651|AAF47766.1| 4097|Drosophila melanogaster CG12008-PA,
            isoform A protein.
          Length = 4097

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 16/61 (26%), Positives = 32/61 (52%)
 Frame = -2

Query: 196  DVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGGECLSLFSG 17
            ++E  L  R+   R  + G+   +   ++  H T+ L+ LD YSG+V  +G  C ++ + 
Sbjct: 1724 EIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELE-LDTYSGIVTEMGHSCAAMVAA 1782

Query: 16   D 14
            +
Sbjct: 1783 N 1783


>AE014296-650|AAS64958.1| 4118|Drosophila melanogaster CG12008-PB,
            isoform B protein.
          Length = 4118

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 16/61 (26%), Positives = 32/61 (52%)
 Frame = -2

Query: 196  DVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGGECLSLFSG 17
            ++E  L  R+   R  + G+   +   ++  H T+ L+ LD YSG+V  +G  C ++ + 
Sbjct: 1724 EIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELE-LDTYSGIVTEMGHSCAAMVAA 1782

Query: 16   D 14
            +
Sbjct: 1783 N 1783


>AE014296-649|AAS64957.1| 4207|Drosophila melanogaster CG12008-PC,
            isoform C protein.
          Length = 4207

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 16/61 (26%), Positives = 32/61 (52%)
 Frame = -2

Query: 196  DVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGGECLSLFSG 17
            ++E  L  R+   R  + G+   +   ++  H T+ L+ LD YSG+V  +G  C ++ + 
Sbjct: 1724 EIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELE-LDTYSGIVTEMGHSCAAMVAA 1782

Query: 16   D 14
            +
Sbjct: 1783 N 1783


>AE014134-2952|AAF53685.2|  826|Drosophila melanogaster CG31790-PA
           protein.
          Length = 826

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = +1

Query: 169 ASN*GH-LRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDD 345
           A N  H L  RC++Y      R++  Q +++T +   G   KEE+    +   + +N  D
Sbjct: 245 AGNHNHELEGRCRQYE-----RDLQIQRDRLTESEINGEKLKEELRGFESRCHRLQNNLD 299

Query: 346 KAKGD 360
           + +GD
Sbjct: 300 RTQGD 304


>AE014134-886|AAZ66447.1| 7744|Drosophila melanogaster CG33715-PB,
            isoform B protein.
          Length = 7744

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 12/29 (41%), Positives = 20/29 (68%)
 Frame = +1

Query: 226  YREVHQQGEQITITNDKGRLSKEEIERMV 312
            +RE++QQ E + +T  + R  KEE ER++
Sbjct: 4595 FREINQQKENLEVTMVQWRAYKEEYERLM 4623


>AE014134-885|AAZ66446.1| 11707|Drosophila melanogaster CG33715-PD,
            isoform D protein.
          Length = 11707

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 12/29 (41%), Positives = 20/29 (68%)
 Frame = +1

Query: 226  YREVHQQGEQITITNDKGRLSKEEIERMV 312
            +RE++QQ E + +T  + R  KEE ER++
Sbjct: 4595 FREINQQKENLEVTMVQWRAYKEEYERLM 4623


>BT025953-1|ABG02197.1|  352|Drosophila melanogaster IP15285p
           protein.
          Length = 352

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 25/119 (21%), Positives = 50/119 (42%)
 Frame = +2

Query: 149 PPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRS 328
           P APRG+     T +  +       A   S      +P  T    +    +++    Q +
Sbjct: 118 PGAPRGIKSA-ATLEASSTTTAPPRAAGVSVAAATSAPAATAATAAS---AAITAAIQAT 173

Query: 329 TETRMTRQKETIQGQECIGILLASA*SATMEDEKLKEKILLNSDKQTIPRTSATSTHSS 505
             T  TR++ T+  +  +G +     +A +ED+  +  I   ++K   P T +T++ S+
Sbjct: 174 AATSPTREQHTLPPRPAVGQMARINVAAIIEDQIGRAVIPSTTNKAETPATPSTTSTST 232


>AY119169-1|AAM51029.1|  918|Drosophila melanogaster RH46576p
           protein.
          Length = 918

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 13/45 (28%), Positives = 24/45 (53%)
 Frame = +1

Query: 187 LRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEA 321
           L+ RC   P   R +E+HQ  +  TI N+   + ++++ R   +A
Sbjct: 130 LKPRCFNPPSNLRLKEIHQMLD--TIANEDTEVKQQQLIRFTEQA 172


>AE014298-2186|AAF48484.1|  410|Drosophila melanogaster CG15646-PA
           protein.
          Length = 410

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +2

Query: 245 KENRSPLPTTKVVSPRKRSSVWLMRQR--STETRMTRQKETIQGQECIGILLASA*SATM 418
           +E RSP+PT       KR S+ L RQR    + ++T +  +   Q    +L A+   + +
Sbjct: 293 REVRSPVPTESESQDAKRHSLQLRRQRVVRRKRKITTKISSSVRQSAQKLLAAARSGSAV 352

Query: 419 EDEKLKEKILLNSDKQTIPRTSATSTHSSGWDFQSRLAEQG 541
             ++  +K      ++ I   S  S H+S  DF+  L   G
Sbjct: 353 PSQRFAQK------RRHI---SPDSGHNSTSDFEEELVAMG 384


>AE014298-1936|AAF48298.1|  918|Drosophila melanogaster CG12176-PA
           protein.
          Length = 918

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 13/45 (28%), Positives = 24/45 (53%)
 Frame = +1

Query: 187 LRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEA 321
           L+ RC   P   R +E+HQ  +  TI N+   + ++++ R   +A
Sbjct: 130 LKPRCFNPPSNLRLKEIHQMLD--TIANEDTEVKQQQLIRFTEQA 172


>AE013599-660|AAF59081.2| 1264|Drosophila melanogaster CG30361-PA,
           isoform A protein.
          Length = 1264

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 25/119 (21%), Positives = 50/119 (42%)
 Frame = +2

Query: 149 PPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRS 328
           P APRG+     T +  +       A   S      +P  T    +    +++    Q +
Sbjct: 13  PGAPRGIKSA-ATLEASSTTTAPPRAAGVSVAAATSAPAATAATAAS---AAITAAIQAT 68

Query: 329 TETRMTRQKETIQGQECIGILLASA*SATMEDEKLKEKILLNSDKQTIPRTSATSTHSS 505
             T  TR++ T+  +  +G +     +A +ED+  +  I   ++K   P T +T++ S+
Sbjct: 69  AATSPTREQHTLPPRPAVGQMARINVAAIIEDQIGRAVIPSTTNKAETPATPSTTSTST 127


>M94375-1|AAA28551.1| 1680|Drosophila melanogaster furin2 protein.
          Length = 1680

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 1166 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 1216


>L33831-1|AAA69860.1| 1679|Drosophila melanogaster Dfurin2 protein.
          Length = 1679

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 1165 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 1215


>BT021414-1|AAX33562.1| 1061|Drosophila melanogaster LD05524p
           protein.
          Length = 1061

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493 GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
           GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 547 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 597


>AY070553-1|AAL48024.1| 1376|Drosophila melanogaster LD30182p protein.
          Length = 1376

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 862  GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 912


>AE014298-2387|AAS65387.1| 1679|Drosophila melanogaster CG18734-PG,
            isoform G protein.
          Length = 1679

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 1165 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 1215


>AE014298-2386|AAN09402.1| 1679|Drosophila melanogaster CG18734-PF,
            isoform F protein.
          Length = 1679

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 1165 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 1215


>AE014298-2385|AAN09401.1| 1679|Drosophila melanogaster CG18734-PE,
            isoform E protein.
          Length = 1679

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 1165 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 1215


>AE014298-2384|AAN09400.1| 1679|Drosophila melanogaster CG18734-PD,
            isoform D protein.
          Length = 1679

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 1165 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 1215


>AE014298-2383|AAN09399.1| 1682|Drosophila melanogaster CG18734-PC,
            isoform C protein.
          Length = 1682

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 1168 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 1218


>AE014298-2382|AAF48599.2| 1682|Drosophila melanogaster CG18734-PB,
            isoform B protein.
          Length = 1682

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 1168 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 1218


>AE014298-2381|AAF48598.2| 1682|Drosophila melanogaster CG18734-PA,
            isoform A protein.
          Length = 1682

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 493  GCCTCSRNGLLVRVQENLFL---ELLILHGSTSC*SQ*DSNAFLALDGLLLPCH 341
            GC TC+ NG+     +N  L   +  I+ GS  C    +S  +  ++G   PCH
Sbjct: 1168 GCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGC---SESEFYSQVEGQCRPCH 1218


>AE014297-519|AAF54083.2|  586|Drosophila melanogaster CG2189-PA
           protein.
          Length = 586

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 15/60 (25%), Positives = 26/60 (43%)
 Frame = +2

Query: 203 NGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECI 382
           N + N   + K T   N +P P  K  + R  S      Q+  +++  + ++T    ECI
Sbjct: 425 NKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECI 484


>AE001572-6|AAD19796.1|  586|Drosophila melanogaster homeodomain
           protein protein.
          Length = 586

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 15/60 (25%), Positives = 26/60 (43%)
 Frame = +2

Query: 203 NGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECI 382
           N + N   + K T   N +P P  K  + R  S      Q+  +++  + ++T    ECI
Sbjct: 425 NKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECI 484


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,046,447
Number of Sequences: 53049
Number of extensions: 666979
Number of successful extensions: 2877
Number of sequences better than 10.0: 168
Number of HSP's better than 10.0 without gapping: 2393
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2858
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2497240350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).