SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY070616-1|AAL48087.1|  197|Drosophila melanogaster RE71854p pro...    66   3e-11
AE014134-1356|AAF52571.2|  197|Drosophila melanogaster CG14534-P...    66   3e-11
BT028801-1|ABI34182.1|  286|Drosophila melanogaster LP21747p pro...    60   3e-09
BT004476-1|AAO42640.1|  286|Drosophila melanogaster LP07342p pro...    60   3e-09
AE014297-4048|AAF56656.1|  286|Drosophila melanogaster CG5812-PA...    60   3e-09
AJ271041-1|CAB66004.1|  286|Drosophila melanogaster Gly-rich pro...    58   9e-09
AY075518-1|AAL68326.1|  278|Drosophila melanogaster RE68367p pro...    57   2e-08
AE014297-28|AAF52158.1|  278|Drosophila melanogaster CG14643-PA ...    57   2e-08
AY071066-1|AAL48688.1|  198|Drosophila melanogaster RE14272p pro...    51   2e-06
AE013599-1351|AAF58614.1|  198|Drosophila melanogaster CG8986-PA...    51   2e-06
BT022947-1|AAY55363.1|  346|Drosophila melanogaster IP11207p pro...    47   3e-05
AE014298-2469|AAN09419.1|  346|Drosophila melanogaster CG32571-P...    47   3e-05
BT021279-1|AAX33427.1|  392|Drosophila melanogaster RE40185p pro...    46   7e-05
AE014297-4038|AAF56647.1|  360|Drosophila melanogaster CG14254-P...    46   7e-05
BT001478-1|AAN71233.1|  308|Drosophila melanogaster LD21452p pro...    38   0.018
AE014297-2327|AAF55398.2|  308|Drosophila melanogaster CG4060-PA...    38   0.018
AY061275-1|AAL28823.1|  354|Drosophila melanogaster LD19715p pro...    37   0.023
AE014297-27|AAF52159.1|  354|Drosophila melanogaster CG14639-PA ...    37   0.023
AY118694-1|AAM50554.1|  360|Drosophila melanogaster AT18267p pro...    36   0.071
AE014298-2473|AAN09422.1|  388|Drosophila melanogaster CG32574-P...    36   0.071
AY113488-1|AAM29493.1|  435|Drosophila melanogaster RE47056p pro...    35   0.12 
AE014134-1066|AAF52356.2|  808|Drosophila melanogaster CG31640-P...    35   0.12 
AE014298-2471|AAN09421.1|  223|Drosophila melanogaster CG32569-P...    32   0.66 
AE014297-30|AAF52156.1|  251|Drosophila melanogaster CG14640-PA ...    32   0.87 
AY069690-1|AAL39835.1|  494|Drosophila melanogaster LD46328p pro...    31   2.0  
AE014297-2874|AAF55812.2|  494|Drosophila melanogaster CG33094-P...    31   2.0  
M87038-1|AAA28427.1|  516|Drosophila melanogaster CREB-A protein.      30   3.5  
BT025219-1|ABF17910.1|  516|Drosophila melanogaster FI01021p pro...    30   3.5  
BT021243-1|AAX33391.1|  320|Drosophila melanogaster RE64328p pro...    30   3.5  
BT011074-1|AAR82739.1|  296|Drosophila melanogaster SD14261p pro...    30   3.5  
AE014297-1476|AAF54775.1|  588|Drosophila melanogaster CG4066-PA...    30   3.5  
AE014296-2531|AAS64997.1|  516|Drosophila melanogaster CG7450-PB...    30   3.5  
AE014296-2530|AAF49621.2|  516|Drosophila melanogaster CG7450-PA...    30   3.5  
BT014653-1|AAT27277.1|  247|Drosophila melanogaster RE02040p pro...    29   4.7  
AY121620-1|AAM51947.1| 1353|Drosophila melanogaster GH06739p pro...    29   4.7  
AY058507-1|AAL13736.1|  243|Drosophila melanogaster LD21404p pro...    29   4.7  
AL021106-11|CAA15945.1|  254|Drosophila melanogaster EG:63B12.2 ...    29   4.7  
AE014298-2470|AAN09420.1|  247|Drosophila melanogaster CG32570-P...    29   4.7  
AE014298-282|AAF45685.1|  243|Drosophila melanogaster CG3109-PA ...    29   4.7  
AE013599-2803|AAF57611.2| 1353|Drosophila melanogaster CG15105-P...    29   4.7  
AE013599-2802|AAF57612.2| 1353|Drosophila melanogaster CG15105-P...    29   4.7  
BT030427-1|ABO52847.1|  159|Drosophila melanogaster IP17891p pro...    29   8.1  

>AY070616-1|AAL48087.1|  197|Drosophila melanogaster RE71854p
           protein.
          Length = 197

 Score = 66.5 bits (155), Expect = 3e-11
 Identities = 29/44 (65%), Positives = 35/44 (79%), Gaps = 1/44 (2%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIP-GVAPPQKHYKIIFIKGPN 560
           P++ KH+YVHVPPPEP E + PR P  V PPQKHYKI+FIK P+
Sbjct: 59  PVIHKHVYVHVPPPEP-EYQAPRKPLYVPPPQKHYKIVFIKAPS 101



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/20 (95%), Positives = 20/20 (100%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTPA 682
           VYVLVKKPEEQP+IIIPTPA
Sbjct: 122 VYVLVKKPEEQPEIIIPTPA 141


>AE014134-1356|AAF52571.2|  197|Drosophila melanogaster CG14534-PA
           protein.
          Length = 197

 Score = 66.5 bits (155), Expect = 3e-11
 Identities = 29/44 (65%), Positives = 35/44 (79%), Gaps = 1/44 (2%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIP-GVAPPQKHYKIIFIKGPN 560
           P++ KH+YVHVPPPEP E + PR P  V PPQKHYKI+FIK P+
Sbjct: 59  PVIHKHVYVHVPPPEP-EYQAPRKPLYVPPPQKHYKIVFIKAPS 101



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/20 (95%), Positives = 20/20 (100%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTPA 682
           VYVLVKKPEEQP+IIIPTPA
Sbjct: 122 VYVLVKKPEEQPEIIIPTPA 141


>BT028801-1|ABI34182.1|  286|Drosophila melanogaster LP21747p
           protein.
          Length = 286

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQR-LPRIPGVAPPQKHYKIIFIKGPNSSHSYCP 581
           LVQKHIYVHVPPPE  E R  P +P +   QKHYKIIFIK P+      P
Sbjct: 130 LVQKHIYVHVPPPEQEEVRQRPNLP-IGQSQKHYKIIFIKAPSPPSYQAP 178



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/20 (85%), Positives = 19/20 (95%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTPA 682
           VYVLVKKPE+Q DI+IPTPA
Sbjct: 192 VYVLVKKPEDQQDIVIPTPA 211



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>BT004476-1|AAO42640.1|  286|Drosophila melanogaster LP07342p
           protein.
          Length = 286

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQR-LPRIPGVAPPQKHYKIIFIKGPNSSHSYCP 581
           LVQKHIYVHVPPPE  E R  P +P +   QKHYKIIFIK P+      P
Sbjct: 130 LVQKHIYVHVPPPEQEEVRQRPNLP-IGQSQKHYKIIFIKAPSPPSYQAP 178



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/20 (85%), Positives = 19/20 (95%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTPA 682
           VYVLVKKPE+Q DI+IPTPA
Sbjct: 192 VYVLVKKPEDQQDIVIPTPA 211



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>AE014297-4048|AAF56656.1|  286|Drosophila melanogaster CG5812-PA
           protein.
          Length = 286

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQR-LPRIPGVAPPQKHYKIIFIKGPNSSHSYCP 581
           LVQKHIYVHVPPPE  E R  P +P +   QKHYKIIFIK P+      P
Sbjct: 130 LVQKHIYVHVPPPEQEEVRQRPNLP-IGQSQKHYKIIFIKAPSPPSYQAP 178



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/20 (85%), Positives = 19/20 (95%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTPA 682
           VYVLVKKPE+Q DI+IPTPA
Sbjct: 192 VYVLVKKPEDQQDIVIPTPA 211



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>AJ271041-1|CAB66004.1|  286|Drosophila melanogaster Gly-rich
           protein protein.
          Length = 286

 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVE-QRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCP 581
           LVQKHIYVHVPPPE  E  + P +P +   QKHYKIIFIK P+      P
Sbjct: 130 LVQKHIYVHVPPPEQEEVGQRPNLP-IGQSQKHYKIIFIKAPSPPSYQAP 178



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/20 (85%), Positives = 19/20 (95%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTPA 682
           VYVLVKKPE+Q DI+IPTPA
Sbjct: 192 VYVLVKKPEDQQDIVIPTPA 211



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +1

Query: 109 MRAFVVLACVAMAYGRPEPPVGYSYSAP 192
           M+AF++++C+A+A  RPE   GY+Y+ P
Sbjct: 1   MKAFILMSCLALAAARPE--AGYNYNRP 26


>AY075518-1|AAL68326.1|  278|Drosophila melanogaster RE68367p
           protein.
          Length = 278

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRLPR-IPGVAPPQKHYKIIFIKGPNSSHS 572
           LV K IYVHVPP E  E R P+ +   APP+KHY+I+FIK P +S S
Sbjct: 112 LVSKDIYVHVPPAEEPEDRYPQPVLPPAPPRKHYRIVFIKAPTTSVS 158


>AE014297-28|AAF52158.1|  278|Drosophila melanogaster CG14643-PA
           protein.
          Length = 278

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRLPR-IPGVAPPQKHYKIIFIKGPNSSHS 572
           LV K IYVHVPP E  E R P+ +   APP+KHY+I+FIK P +S S
Sbjct: 112 LVSKDIYVHVPPAEEPEDRYPQPVLPPAPPRKHYRIVFIKAPTTSVS 158


>AY071066-1|AAL48688.1|  198|Drosophila melanogaster RE14272p
           protein.
          Length = 198

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 24/42 (57%), Positives = 27/42 (64%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPN 560
           LV K++YVHVPP EP           A P+KHYKIIFIK PN
Sbjct: 69  LVTKNVYVHVPPEEPEFYPASSPIQTAVPKKHYKIIFIKAPN 110



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTP 679
           VYVLVKKPEEQ  +I+P P
Sbjct: 131 VYVLVKKPEEQQPVILPAP 149


>AE013599-1351|AAF58614.1|  198|Drosophila melanogaster CG8986-PA
           protein.
          Length = 198

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 24/42 (57%), Positives = 27/42 (64%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPN 560
           LV K++YVHVPP EP           A P+KHYKIIFIK PN
Sbjct: 69  LVTKNVYVHVPPEEPEFYPASSPIQTAVPKKHYKIIFIKAPN 110



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTP 679
           VYVLVKKPEEQ  +I+P P
Sbjct: 131 VYVLVKKPEEQQPVILPAP 149


>BT022947-1|AAY55363.1|  346|Drosophila melanogaster IP11207p
           protein.
          Length = 346

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 18/45 (40%), Positives = 28/45 (62%)
 Frame = +3

Query: 438 VQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHS 572
           + KH Y+H  P +  EQ++ R   V  PQK+Y+++FI  P S+ S
Sbjct: 147 INKHFYIHSAPEDHDEQQIVRYVNVGRPQKNYRVVFINAPTSTAS 191


>AE014298-2469|AAN09419.1|  346|Drosophila melanogaster CG32571-PA
           protein.
          Length = 346

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 18/45 (40%), Positives = 28/45 (62%)
 Frame = +3

Query: 438 VQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHS 572
           + KH Y+H  P +  EQ++ R   V  PQK+Y+++FI  P S+ S
Sbjct: 147 INKHFYIHSAPEDHDEQQIVRYVNVGRPQKNYRVVFINAPTSTAS 191


>BT021279-1|AAX33427.1|  392|Drosophila melanogaster RE40185p
           protein.
          Length = 392

 Score = 45.6 bits (103), Expect = 7e-05
 Identities = 23/47 (48%), Positives = 30/47 (63%), Gaps = 5/47 (10%)
 Frame = +3

Query: 438 VQKHIYVHVPPPE-----PVEQRLPRIPGVAPPQKHYKIIFIKGPNS 563
           V KHIYVHVPP +      ++ R+    G  P QKHYKI+FIK P++
Sbjct: 159 VHKHIYVHVPPKDFEEEDAIQTRVHHQQG--PKQKHYKIVFIKAPSA 203



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTP 679
           +YVL KKPE++ DI+IPTP
Sbjct: 223 IYVLHKKPEQEQDIVIPTP 241



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)
 Frame = +1

Query: 67  VSSKRISLVSSKHKMRAFVVL---ACVAMAYGRPEPPVGYSY 183
           +SSK   +  SK ++ +  V+   + VA   GRPEPP  YSY
Sbjct: 21  LSSKGFPITRSKMRVSSLFVVCVASLVATTLGRPEPPSPYSY 62


>AE014297-4038|AAF56647.1|  360|Drosophila melanogaster CG14254-PA
           protein.
          Length = 360

 Score = 45.6 bits (103), Expect = 7e-05
 Identities = 23/47 (48%), Positives = 30/47 (63%), Gaps = 5/47 (10%)
 Frame = +3

Query: 438 VQKHIYVHVPPPE-----PVEQRLPRIPGVAPPQKHYKIIFIKGPNS 563
           V KHIYVHVPP +      ++ R+    G  P QKHYKI+FIK P++
Sbjct: 127 VHKHIYVHVPPKDFEEEDAIQTRVHHQQG--PKQKHYKIVFIKAPSA 171



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +2

Query: 623 VYVLVKKPEEQPDIIIPTP 679
           +YVL KKPE++ DI+IPTP
Sbjct: 191 IYVLHKKPEQEQDIVIPTP 209


>BT001478-1|AAN71233.1|  308|Drosophila melanogaster LD21452p
           protein.
          Length = 308

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAP-PQKHYKIIFIKGPNSSHSYCPHNSYPTTKR 608
           P+V K+ ++H  P E  ++    +  +A  P+ HY ++F+K P  ++     N   T K+
Sbjct: 127 PIVTKNFFIHSAPEESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRAAALNLAKTLKQ 186

Query: 609 REDTPYM 629
            +   Y+
Sbjct: 187 EKTVVYV 193


>AE014297-2327|AAF55398.2|  308|Drosophila melanogaster CG4060-PA
           protein.
          Length = 308

 Score = 37.5 bits (83), Expect = 0.018
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAP-PQKHYKIIFIKGPNSSHSYCPHNSYPTTKR 608
           P+V K+ ++H  P E  ++    +  +A  P+ HY ++F+K P  ++     N   T K+
Sbjct: 127 PIVTKNFFIHSAPEESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRAAALNLAKTLKQ 186

Query: 609 REDTPYM 629
            +   Y+
Sbjct: 187 EKTVVYV 193


>AY061275-1|AAL28823.1|  354|Drosophila melanogaster LD19715p
           protein.
          Length = 354

 Score = 37.1 bits (82), Expect = 0.023
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRL--PRIPGVAPPQKHYKIIFIKGPNSSHSY 575
           +V K IY+H  P E  E R   P +  V P +K+Y+I+FIK P+ +  Y
Sbjct: 138 IVTKDIYIHSAPEENEELRQDEPLLENV-PIRKNYRIVFIKAPSQNLKY 185


>AE014297-27|AAF52159.1|  354|Drosophila melanogaster CG14639-PA
           protein.
          Length = 354

 Score = 37.1 bits (82), Expect = 0.023
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRL--PRIPGVAPPQKHYKIIFIKGPNSSHSY 575
           +V K IY+H  P E  E R   P +  V P +K+Y+I+FIK P+ +  Y
Sbjct: 138 IVTKDIYIHSAPEENEELRQDEPLLENV-PIRKNYRIVFIKAPSQNLKY 185


>AY118694-1|AAM50554.1|  360|Drosophila melanogaster AT18267p
           protein.
          Length = 360

 Score = 35.5 bits (78), Expect = 0.071
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHS 572
           P++ K  +    P E       +   +  PQK+Y+++FIK P+SS++
Sbjct: 143 PIIHKQFFTVAAPEEHENLERSKHLVIGRPQKNYRVVFIKAPSSSNA 189


>AE014298-2473|AAN09422.1|  388|Drosophila melanogaster CG32574-PA
           protein.
          Length = 388

 Score = 35.5 bits (78), Expect = 0.071
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHS 572
           P++ K  +    P E       +   +  PQK+Y+++FIK P+SS++
Sbjct: 171 PIIHKQFFTVAAPEEHENLERSKHLVIGRPQKNYRVVFIKAPSSSNA 217


>AY113488-1|AAM29493.1|  435|Drosophila melanogaster RE47056p
           protein.
          Length = 435

 Score = 34.7 bits (76), Expect = 0.12
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 6/54 (11%)
 Frame = +3

Query: 447 HIYVHVPPPEPVEQRLPRIPGVAPP--QKHY--KIIF--IKGPNSSHSYCPHNS 590
           ++ V   PP P+    PR P V PP  +K+Y    IF  +KGP S  S C  N+
Sbjct: 303 YVNVRRTPPPPLSSIFPRPPTVPPPPMEKYYATTAIFKPLKGPGSERSGCSSNT 356


>AE014134-1066|AAF52356.2|  808|Drosophila melanogaster CG31640-PA
           protein.
          Length = 808

 Score = 34.7 bits (76), Expect = 0.12
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 6/54 (11%)
 Frame = +3

Query: 447 HIYVHVPPPEPVEQRLPRIPGVAPP--QKHY--KIIF--IKGPNSSHSYCPHNS 590
           ++ V   PP P+    PR P V PP  +K+Y    IF  +KGP S  S C  N+
Sbjct: 533 YVNVRRTPPPPLSSIFPRPPTVPPPPMEKYYATTAIFKPLKGPGSERSGCSSNT 586


>AE014298-2471|AAN09421.1|  223|Drosophila melanogaster CG32569-PA
           protein.
          Length = 223

 Score = 32.3 bits (70), Expect = 0.66
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
 Frame = +3

Query: 432 PLVQKHIYVHVPP--PEPVEQRLPRIPGVAPPQKHYKIIFIKGP--NSSH 569
           P++ K  Y   P   PE +E R   +  +  P+++Y++IFI+ P  NS H
Sbjct: 46  PIITKQFYSISPAEDPEDLEPRTKHLV-IGQPRRNYRVIFIRAPTGNSEH 94


>AE014297-30|AAF52156.1|  251|Drosophila melanogaster CG14640-PA
           protein.
          Length = 251

 Score = 31.9 bits (69), Expect = 0.87
 Identities = 13/45 (28%), Positives = 25/45 (55%)
 Frame = +3

Query: 435 LVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSH 569
           +V K  ++H  P E  + +   I  V  P+++Y ++FIK P  ++
Sbjct: 78  IVSKRFFIHSAPEEAEDYKERHIT-VGVPKRNYNVVFIKSPQRNN 121


>AY069690-1|AAL39835.1|  494|Drosophila melanogaster LD46328p
           protein.
          Length = 494

 Score = 30.7 bits (66), Expect = 2.0
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = -3

Query: 422 VSTRISATESSI-TSEAQTAAAAKGESTTETESIRRVSAAKGNAA 291
           V + I+ T+SS+ TSEA+T+AA  G +T    +    +A+  N++
Sbjct: 361 VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSS 405


>AE014297-2874|AAF55812.2|  494|Drosophila melanogaster CG33094-PB
           protein.
          Length = 494

 Score = 30.7 bits (66), Expect = 2.0
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = -3

Query: 422 VSTRISATESSI-TSEAQTAAAAKGESTTETESIRRVSAAKGNAA 291
           V + I+ T+SS+ TSEA+T+AA  G +T    +    +A+  N++
Sbjct: 361 VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSS 405


>M87038-1|AAA28427.1|  516|Drosophila melanogaster CREB-A protein.
          Length = 516

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRR 318
           S R+S T +SIT  +  +A+A G ST+ T +  R
Sbjct: 359 SVRVSRTAASITRSSSGSASASGSSTSSTVTTTR 392


>BT025219-1|ABF17910.1|  516|Drosophila melanogaster FI01021p
           protein.
          Length = 516

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRR 318
           S R+S T +SIT  +  +A+A G ST+ T +  R
Sbjct: 359 SVRVSRTAASITRSSSGSASASGSSTSSTVTTTR 392


>BT021243-1|AAX33391.1|  320|Drosophila melanogaster RE64328p
           protein.
          Length = 320

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRR 318
           S R+S T +SIT  +  +A+A G ST+ T +  R
Sbjct: 163 SVRVSRTAASITRSSSGSASASGSSTSSTVTTTR 196


>BT011074-1|AAR82739.1|  296|Drosophila melanogaster SD14261p
           protein.
          Length = 296

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRR 318
           S R+S T +SIT  +  +A+A G ST+ T +  R
Sbjct: 139 SVRVSRTAASITRSSSGSASASGSSTSSTVTTTR 172


>AE014297-1476|AAF54775.1|  588|Drosophila melanogaster CG4066-PA
           protein.
          Length = 588

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = -3

Query: 428 TRVSTRISATESSITSEAQTAAAAKGESTTETESIRRVSAA 306
           T VST  S T +S TS + + +     +TTET ++   SA+
Sbjct: 138 TTVSTTSSTTTTSTTSPSTSDSTTNNSTTTETTTVPTTSAS 178


>AE014296-2531|AAS64997.1|  516|Drosophila melanogaster CG7450-PB,
           isoform B protein.
          Length = 516

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRR 318
           S R+S T +SIT  +  +A+A G ST+ T +  R
Sbjct: 359 SVRVSRTAASITRSSSGSASASGSSTSSTVTTTR 392


>AE014296-2530|AAF49621.2|  516|Drosophila melanogaster CG7450-PA,
           isoform A protein.
          Length = 516

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRR 318
           S R+S T +SIT  +  +A+A G ST+ T +  R
Sbjct: 359 SVRVSRTAASITRSSSGSASASGSSTSSTVTTTR 392


>BT014653-1|AAT27277.1|  247|Drosophila melanogaster RE02040p
           protein.
          Length = 247

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 12/42 (28%), Positives = 22/42 (52%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGP 557
           P++ K  Y+   P +       +   +  PQK+Y+++FIK P
Sbjct: 76  PIINKKFYLVSAPEDHSNDGKVKHLVLGRPQKNYRVVFIKAP 117


>AY121620-1|AAM51947.1| 1353|Drosophila melanogaster GH06739p
           protein.
          Length = 1353

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKG-ESTTETESIRRVSAAKGNAASRKAT*GS 267
           S+  S   +++ES   SE +T A +    STT T+S    +A+   AAS   T GS
Sbjct: 681 SSSSSEEETSSESESESEPETKAKSSATSSTTNTKSTPNSAASSTTAASSSTTSGS 736


>AY058507-1|AAL13736.1|  243|Drosophila melanogaster LD21404p
           protein.
          Length = 243

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIP-GVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P+  +++     P   V +R P++P  + PP+   ++ +++GP   H+   H  Y
Sbjct: 34  PIKYQNVEQPERPKLRVIERQPQLPPNIRPPKMQKRLRYMRGPEMVHNTLLHKQY 88


>AL021106-11|CAA15945.1|  254|Drosophila melanogaster EG:63B12.2
           protein.
          Length = 254

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIP-GVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P+  +++     P   V +R P++P  + PP+   ++ +++GP   H+   H  Y
Sbjct: 45  PIKYQNVEQPERPKLRVIERQPQLPPNIRPPKMQKRLRYMRGPEMVHNTLLHKQY 99


>AE014298-2470|AAN09420.1|  247|Drosophila melanogaster CG32570-PA
           protein.
          Length = 247

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 12/42 (28%), Positives = 22/42 (52%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGP 557
           P++ K  Y+   P +       +   +  PQK+Y+++FIK P
Sbjct: 76  PIINKKFYLVSAPEDHSNDGKVKHLVLGRPQKNYRVVFIKAP 117


>AE014298-282|AAF45685.1|  243|Drosophila melanogaster CG3109-PA
           protein.
          Length = 243

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 432 PLVQKHIYVHVPPPEPVEQRLPRIP-GVAPPQKHYKIIFIKGPNSSHSYCPHNSY 593
           P+  +++     P   V +R P++P  + PP+   ++ +++GP   H+   H  Y
Sbjct: 34  PIKYQNVEQPERPKLRVIERQPQLPPNIRPPKMQKRLRYMRGPEMVHNTLLHKQY 88


>AE013599-2803|AAF57611.2| 1353|Drosophila melanogaster CG15105-PB,
           isoform B protein.
          Length = 1353

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKG-ESTTETESIRRVSAAKGNAASRKAT*GS 267
           S+  S   +++ES   SE +T A +    STT T+S    +A+   AAS   T GS
Sbjct: 681 SSSSSEEETSSESESESEPETKAKSSATSSTTNTKSTPNSAASSTTAASSSTTSGS 736


>AE013599-2802|AAF57612.2| 1353|Drosophila melanogaster CG15105-PA,
           isoform A protein.
          Length = 1353

 Score = 29.5 bits (63), Expect = 4.7
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = -3

Query: 431 STRVSTRISATESSITSEAQTAAAAKG-ESTTETESIRRVSAAKGNAASRKAT*GS 267
           S+  S   +++ES   SE +T A +    STT T+S    +A+   AAS   T GS
Sbjct: 681 SSSSSEEETSSESESESEPETKAKSSATSSTTNTKSTPNSAASSTTAASSSTTSGS 736


>BT030427-1|ABO52847.1|  159|Drosophila melanogaster IP17891p
           protein.
          Length = 159

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -3

Query: 551 LDEDDLVMFLGWSHTRDTRKSLLNWFWGRYVNIDVFLYKR 432
           LDEDDLV+ LG       R  +  W   R++++ V  ++R
Sbjct: 103 LDEDDLVVLLGNGRLDGRRGRIELWLLWRHMHVHVLGHER 142


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,321,113
Number of Sequences: 53049
Number of extensions: 436806
Number of successful extensions: 2263
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 2001
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2248
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3108380451
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).