SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X62636-1|CAA44502.1|  326|Drosophila melanogaster hrp36.1 protein.    143   2e-34
X59691-1|CAA42212.1|  386|Drosophila melanogaster P11 (hnRNP pro...   143   2e-34
X58183-1|CAA41170.1|  386|Drosophila melanogaster heterogeneous ...   143   2e-34
X54803-1|CAA38574.1|  386|Drosophila melanogaster Hrb87F protein.     143   2e-34
BT012315-1|AAS77440.1|  385|Drosophila melanogaster LD32727p pro...   143   2e-34
AE014297-1716|AAF54967.1|  385|Drosophila melanogaster CG12749-P...   143   2e-34
AE014297-1715|AAN13574.1|  325|Drosophila melanogaster CG12749-P...   143   2e-34
M25545-4|AAA28621.1|  361|Drosophila melanogaster protein ( D.me...   138   8e-33
M25545-3|AAA28624.1|  365|Drosophila melanogaster protein ( D.me...   138   8e-33
M25545-2|AAA28623.1|  360|Drosophila melanogaster protein ( D.me...   138   8e-33
M25545-1|AAA28622.1|  364|Drosophila melanogaster protein ( D.me...   138   8e-33
M15766-1|AAA70426.1|  365|Drosophila melanogaster unknown protei...   138   8e-33
AY061448-1|AAL28996.1|  361|Drosophila melanogaster LD38464p pro...   138   8e-33
AE014297-4248|AAN14144.1|  361|Drosophila melanogaster CG9983-PF...   138   8e-33
AE014297-4247|AAN14143.1|  361|Drosophila melanogaster CG9983-PD...   138   8e-33
AE014297-4246|AAN14142.1|  365|Drosophila melanogaster CG9983-PC...   138   8e-33
AE014297-4245|AAF56801.1|  365|Drosophila melanogaster CG9983-PB...   138   8e-33
AE014297-4244|AAN14141.1|  360|Drosophila melanogaster CG9983-PE...   138   8e-33
AE014297-4243|AAF56800.2|  364|Drosophila melanogaster CG9983-PA...   138   8e-33
L02106-2|AAA99872.1|  465|Drosophila melanogaster ribonucleoprot...   113   2e-25
L02106-1|AAA99873.1|  471|Drosophila melanogaster ribonucleoprot...   113   2e-25
BT001320-1|AAN71075.1|  434|Drosophila melanogaster AT15526p pro...   113   2e-25
AE014297-4014|AAX53003.1|  434|Drosophila melanogaster CG6354-PE...   113   2e-25
AE014297-4013|AAX53002.1|  434|Drosophila melanogaster CG6354-PD...   113   2e-25
AE014297-4012|AAX53001.1|  471|Drosophila melanogaster CG6354-PI...   113   2e-25
AE014297-4011|AAX53000.1|  471|Drosophila melanogaster CG6354-PH...   113   2e-25
AE014297-4010|AAX52999.1|  471|Drosophila melanogaster CG6354-PF...   113   2e-25
AE014297-4009|AAF56633.1|  471|Drosophila melanogaster CG6354-PB...   113   2e-25
AE014297-4008|AAX52998.1|  465|Drosophila melanogaster CG6354-PG...   113   2e-25
AE014297-4007|AAX52997.1|  465|Drosophila melanogaster CG6354-PC...   113   2e-25
AE014297-4006|AAN14092.1|  465|Drosophila melanogaster CG6354-PA...   113   2e-25
AY122226-1|AAM52738.1|  369|Drosophila melanogaster RE25373p pro...    79   5e-15
AE014296-2876|AAF49366.3|  369|Drosophila melanogaster CG32169-P...    79   5e-15
X79339-1|CAA55897.1|  606|Drosophila melanogaster musashi protein.     78   1e-14
AY119171-1|AAM51031.1|  634|Drosophila melanogaster RH49436p pro...    78   1e-14
AY051802-1|AAK93226.1|  606|Drosophila melanogaster LD31631p pro...    78   1e-14
AE014297-3816|AAF56478.2|  606|Drosophila melanogaster CG5099-PA...    78   1e-14
AE014297-3812|AAN14056.2|  634|Drosophila melanogaster CG5099-PB...    78   1e-14
X62639-1|CAA44505.1|  385|Drosophila melanogaster hrp48.1 protein.     73   6e-13
DQ062784-1|AAY56657.1|  421|Drosophila melanogaster heterogeneou...    73   6e-13
AY128430-1|AAM75023.1|  421|Drosophila melanogaster GH26816p pro...    73   6e-13
AY069699-1|AAL39844.1|  421|Drosophila melanogaster LD46853p pro...    73   6e-13
AE014134-1193|AAN10605.1|  421|Drosophila melanogaster CG10377-P...    73   6e-13
AE014134-1192|AAF52457.1|  421|Drosophila melanogaster CG10377-P...    73   6e-13
AE014134-1191|AAF52456.1|  421|Drosophila melanogaster CG10377-P...    73   6e-13
U18401-1|AAC47508.1|  428|Drosophila melanogaster testis-specifi...    69   5e-12
AY089457-1|AAL90195.1|  428|Drosophila melanogaster AT27014p pro...    69   5e-12
AE014297-1714|AAF54966.1|  428|Drosophila melanogaster CG9654-PA...    69   5e-12
X62638-1|CAA44504.1|  345|Drosophila melanogaster hrp40.2 protein.     52   9e-07
X62637-1|CAA44503.1|  321|Drosophila melanogaster hrp40.1 protein.     52   9e-07
S62100-1|AAB26989.1|  308|Drosophila melanogaster SqdB protein.        52   9e-07
S61875-1|AAB26988.1|  321|Drosophila melanogaster SqdA protein.        52   9e-07
BT023832-1|AAZ86753.1|  308|Drosophila melanogaster LD29474p pro...    52   9e-07
AY118501-1|AAM49870.1|  321|Drosophila melanogaster LD09691p pro...    52   9e-07
AE014297-1708|AAF54964.2|  321|Drosophila melanogaster CG16901-P...    52   9e-07
AE014297-1706|AAF54963.2|  344|Drosophila melanogaster CG16901-P...    52   9e-07
AE014297-1705|AAN13570.1|  308|Drosophila melanogaster CG16901-P...    52   9e-07
AE014298-3112|AAN09672.1|   90|Drosophila melanogaster CG33714-P...    50   3e-06
AE014298-3111|AAN09673.1|   90|Drosophila melanogaster CG33714-P...    50   3e-06
AY118452-1|AAM49821.1|  318|Drosophila melanogaster AT09813p pro...    50   5e-06
AE014296-2502|AAF49643.2|  318|Drosophila melanogaster CG7804-PA...    50   5e-06
BT022083-1|AAY33499.1|  531|Drosophila melanogaster RH39704p pro...    49   8e-06
AY089497-1|AAL90235.1|  531|Drosophila melanogaster GH09868p pro...    49   8e-06
AE013599-3707|AAF47080.2|  332|Drosophila melanogaster CG10327-P...    49   8e-06
AE013599-3706|AAM68274.1|  531|Drosophila melanogaster CG10327-P...    49   8e-06
AE013599-3705|AAF47078.2|  531|Drosophila melanogaster CG10327-P...    49   8e-06
AE013599-3704|AAF47079.2|  531|Drosophila melanogaster CG10327-P...    49   8e-06
AB019707-1|BAA34430.1|  332|Drosophila melanogaster TAR-binding ...    49   8e-06
AB019706-1|BAA34429.1|  531|Drosophila melanogaster TAR-binding ...    49   8e-06
AB019705-1|BAA34428.1|  531|Drosophila melanogaster TAR-binding ...    49   8e-06
AB010261-8|BAA34422.1|  332|Drosophila melanogaster TAR-binding ...    49   8e-06
AB010261-7|BAA34421.1|  531|Drosophila melanogaster TAR-binding ...    49   8e-06
BT003274-1|AAO25031.1|  313|Drosophila melanogaster LD15419p pro...    46   6e-05
BT004860-1|AAO45216.1|  437|Drosophila melanogaster RE27227p pro...    44   2e-04
AF170082-1|AAD47839.1|  419|Drosophila melanogaster cleavage sti...    44   2e-04
AE014297-2555|AAF55577.2|  419|Drosophila melanogaster CG7697-PA...    44   2e-04
L05109-1|AAA70421.1|  632|Drosophila melanogaster poly(A)-bindin...    42   0.001
AY118528-1|AAM49897.1|  634|Drosophila melanogaster LD24412p pro...    42   0.001
AE014297-773|AAF54259.1|   91|Drosophila melanogaster CG8021-PA ...    42   0.001
AE013599-2628|AAS64811.1|  634|Drosophila melanogaster CG5119-PH...    42   0.001
AE013599-2627|AAM68178.1|  634|Drosophila melanogaster CG5119-PG...    42   0.001
AE013599-2626|AAF57747.1|  634|Drosophila melanogaster CG5119-PF...    42   0.001
AE013599-2625|AAM68177.1|  634|Drosophila melanogaster CG5119-PE...    42   0.001
AE013599-2624|AAM68176.1|  634|Drosophila melanogaster CG5119-PD...    42   0.001
AE013599-2623|AAF57746.1|  634|Drosophila melanogaster CG5119-PC...    42   0.001
AE013599-2622|AAF57745.1|  634|Drosophila melanogaster CG5119-PB...    42   0.001
AE013599-2621|AAM68175.1|  634|Drosophila melanogaster CG5119-PA...    42   0.001
AY051860-1|AAK93284.1|  594|Drosophila melanogaster LD35730p pro...    41   0.002
AE014134-1228|AAN10619.1|  287|Drosophila melanogaster CG11266-P...    41   0.002
AE014134-1227|AAN10618.1|  287|Drosophila melanogaster CG11266-P...    41   0.002
AE014134-1226|AAN10615.2|  287|Drosophila melanogaster CG11266-P...    41   0.002
AE014134-1225|AAN10617.1|  287|Drosophila melanogaster CG11266-P...    41   0.002
AE014134-1224|AAN10616.1|  287|Drosophila melanogaster CG11266-P...    41   0.002
AE014134-1223|AAN10614.1|  594|Drosophila melanogaster CG11266-P...    41   0.002
AE014134-1222|AAF52478.1|  594|Drosophila melanogaster CG11266-P...    41   0.002
S51693-1|AAB24624.1|   44|Drosophila melanogaster RNA recognitio...    40   0.004
BT001728-1|AAN71483.1|  470|Drosophila melanogaster RE70333p pro...    40   0.004
AE014296-817|AAF47879.2|  470|Drosophila melanogaster CG1316-PA ...    40   0.004
S55886-1|AAB25519.2|  444|Drosophila melanogaster RRM9 protein.        40   0.005
L04930-2|AAC13646.1|  439|Drosophila melanogaster RNA-binding pr...    40   0.005
L04930-1|AAC13645.1|  444|Drosophila melanogaster RNA-binding pr...    40   0.005
BT029936-1|ABM92810.1|  647|Drosophila melanogaster IP15810p pro...    40   0.005
BT025832-1|ABF85732.1|  791|Drosophila melanogaster IP09238p pro...    40   0.005
BT011197-1|AAR88559.1|  439|Drosophila melanogaster GH26440p pro...    40   0.005
AY121663-1|AAM51990.1|  505|Drosophila melanogaster RE10833p pro...    40   0.005
AE014297-4216|AAF56774.2|  505|Drosophila melanogaster CG12870-P...    40   0.005
AE014134-520|AAX52651.1|  439|Drosophila melanogaster CG3151-PG,...    40   0.005
AE014134-519|AAN10403.1|  439|Drosophila melanogaster CG3151-PF,...    40   0.005
AE014134-518|AAN10402.1|  439|Drosophila melanogaster CG3151-PE,...    40   0.005
AE014134-517|AAF51178.2|  444|Drosophila melanogaster CG3151-PC,...    40   0.005
AE014134-516|AAF51177.2|  444|Drosophila melanogaster CG3151-PB,...    40   0.005
AE014134-515|AAN10401.2|  642|Drosophila melanogaster CG3151-PD,...    40   0.005
AE014134-514|AAF51179.3|  647|Drosophila melanogaster CG3151-PA,...    40   0.005
U73846-1|AAB61993.1|  808|Drosophila melanogaster testis-specifi...    39   0.007
U58976-1|AAB58464.1|  604|Drosophila melanogaster bruno protein.       39   0.007
AY118847-1|AAM50707.1|  181|Drosophila melanogaster GM15173p pro...    39   0.007
AY071650-1|AAL49272.1|  361|Drosophila melanogaster RE72594p pro...    39   0.007
AY071293-1|AAL48915.1|  170|Drosophila melanogaster RE32504p pro...    39   0.007
AY051758-1|AAK93182.1|  604|Drosophila melanogaster LD29068p pro...    39   0.007
AF239667-1|AAF43091.1|  356|Drosophila melanogaster putative RNA...    39   0.007
AE014298-1827|AAF48215.3|  356|Drosophila melanogaster CG4396-PA...    39   0.007
AE014297-3189|AAF56024.1|  356|Drosophila melanogaster CG6937-PA...    39   0.007
AE014134-2184|AAN10813.1|  361|Drosophila melanogaster CG31762-P...    39   0.007
AE014134-2183|AAN10812.1|  604|Drosophila melanogaster CG31762-P...    39   0.007
AE014134-2182|AAN10811.1|  616|Drosophila melanogaster CG31762-P...    39   0.007
AE014134-2181|AAN10810.1|  810|Drosophila melanogaster CG31762-P...    39   0.007
AY089405-1|AAL90143.1|  251|Drosophila melanogaster AT22957p pro...    38   0.011
AE014297-2054|AAF55205.1|  251|Drosophila melanogaster CG5213-PA...    38   0.011
S51720-1|AAB24628.1|   44|Drosophila melanogaster RNA recognitio...    38   0.015
AY060413-1|AAL25452.1|  307|Drosophila melanogaster LD36772p pro...    38   0.015
AE013599-3890|AAF47219.1|  307|Drosophila melanogaster CG4612-PA...    38   0.015
AY060398-1|AAL25437.1|  422|Drosophila melanogaster LD31834p pro...    37   0.026
AE014296-2305|AAF49798.2|  422|Drosophila melanogaster CG12478-P...    37   0.026
AE014296-2304|AAF49799.2|  363|Drosophila melanogaster CG12478-P...    37   0.026
AE014134-3163|AAF53845.1|  154|Drosophila melanogaster CG10466-P...    37   0.035
S51715-1|AAB24627.1|   44|Drosophila melanogaster RNA recognitio...    36   0.046
M21152-1|AAA28506.1|  483|Drosophila melanogaster elav protein.        36   0.061
BT003283-1|AAO25040.1|  178|Drosophila melanogaster HL05737p pro...    36   0.061
BT001384-1|AAN71139.1|  178|Drosophila melanogaster GH03391p pro...    36   0.061
AY122066-1|AAM52578.1|  690|Drosophila melanogaster AT09438p pro...    36   0.061
AY060253-1|AAL25292.1|  238|Drosophila melanogaster GH07919p pro...    36   0.061
AY051822-1|AAK93246.1|  483|Drosophila melanogaster LD33076p pro...    36   0.061
AL022139-2|CAB37430.1|  483|Drosophila melanogaster EG:65F1.2,FB...    36   0.061
AL022139-1|CAA18091.1|  479|Drosophila melanogaster EG:65F1.2,FB...    36   0.061
AE014298-54|AAX52472.1|  479|Drosophila melanogaster CG4262-PB, ...    36   0.061
AE014298-53|AAF45517.2|  483|Drosophila melanogaster CG4262-PA, ...    36   0.061
AE014297-1707|AAS65146.1|  178|Drosophila melanogaster CG16901-P...    36   0.061
AE014134-2187|AAO41184.1|  737|Drosophila melanogaster CG31761-P...    36   0.061
AE014134-2186|ABI31310.1|  893|Drosophila melanogaster CG31761-P...    36   0.061
AE013599-2499|AAG22261.1|  690|Drosophila melanogaster CG4878-PB...    36   0.061
AE013599-2498|AAF57842.1|  690|Drosophila melanogaster CG4878-PA...    36   0.061
M31162-1|AAA28859.1|  448|Drosophila melanogaster protein ( D.me...    36   0.080
AY089622-1|AAL90360.1|  448|Drosophila melanogaster RE35772p pro...    36   0.080
AY071420-1|AAL49042.1|  302|Drosophila melanogaster RE50009p pro...    36   0.080
AY061501-1|AAL29049.1|  448|Drosophila melanogaster LD46049p pro...    36   0.080
AE014297-279|AAF52006.1|  302|Drosophila melanogaster CG2931-PA ...    36   0.080
AE014134-1210|AAF52471.1|  448|Drosophila melanogaster CG8749-PA...    36   0.080
BT010058-1|AAQ22527.1|  865|Drosophila melanogaster LD15974p pro...    35   0.11 
AY118678-1|AAM50538.1|  582|Drosophila melanogaster AT08247p pro...    35   0.11 
AE014296-1825|AAF50154.2|  849|Drosophila melanogaster CG32062-P...    35   0.11 
AE014296-1824|AAF50153.2|  881|Drosophila melanogaster CG32062-P...    35   0.11 
L13038-1|AAA02941.1|  465|Drosophila melanogaster polyadenylate-...    35   0.14 
L13037-1|AAA28828.1|  465|Drosophila melanogaster polyadenylate-...    35   0.14 
AY118564-1|AAM49933.1|  578|Drosophila melanogaster LD40028p pro...    35   0.14 
AY094948-1|AAM11301.1|  379|Drosophila melanogaster RH63980p pro...    35   0.14 
AY070612-1|AAL48083.1|  470|Drosophila melanogaster RE71384p pro...    35   0.14 
AE014297-3445|AAN13978.1|  470|Drosophila melanogaster CG5422-PD...    35   0.14 
AE014297-3444|AAN13977.1|  464|Drosophila melanogaster CG5422-PF...    35   0.14 
AE014297-3443|AAF56224.1|  464|Drosophila melanogaster CG5422-PC...    35   0.14 
AE014297-3442|AAF56225.1|  464|Drosophila melanogaster CG5422-PB...    35   0.14 
AE014296-940|AAF50792.3|  368|Drosophila melanogaster CG32423-PC...    35   0.14 
AE014296-937|AAF50788.5|  578|Drosophila melanogaster CG32423-PA...    35   0.14 
X97197-1|CAA65831.1|  366|Drosophila melanogaster spliceosomal p...    34   0.19 
BT023489-1|AAY84889.1|  347|Drosophila melanogaster RE50839p pro...    34   0.19 
AY113652-1|AAM29657.1|  918|Drosophila melanogaster SD14970p pro...    34   0.19 
AE014298-857|AAF46136.1|  347|Drosophila melanogaster CG3780-PA ...    34   0.19 
AE014296-1695|AAF50237.1|  918|Drosophila melanogaster CG3335-PA...    34   0.19 
S51738-1|AAB24630.1|   44|Drosophila melanogaster RNA recognitio...    34   0.25 
AY061421-1|AAL28969.1|  300|Drosophila melanogaster LD35248p pro...    33   0.43 
AF182826-1|AAF01031.1|  300|Drosophila melanogaster cyclophilin-...    33   0.43 
AF132148-1|AAD34736.1|  653|Drosophila melanogaster unknown prot...    33   0.43 
AE014297-3634|AAF56342.1|  653|Drosophila melanogaster CG5808-PA...    33   0.43 
AE013599-2502|AAF57839.1|  300|Drosophila melanogaster CG4886-PA...    33   0.43 
X79340-1|CAA55898.2|  213|Drosophila melanogaster musashi protein.     33   0.57 
AY069584-1|AAL39729.1|  195|Drosophila melanogaster LD32469p pro...    32   0.75 
AF232775-1|AAF43415.1|  195|Drosophila melanogaster SR family sp...    32   0.75 
AE014134-2203|AAF53192.1|  195|Drosophila melanogaster CG5442-PB...    32   0.75 
BT003317-1|AAO25077.1|  545|Drosophila melanogaster GH01086p pro...    32   0.99 
BT001582-1|AAN71337.1|  977|Drosophila melanogaster RE24907p pro...    32   0.99 
AY061541-1|AAL29089.1|  392|Drosophila melanogaster LP03039p pro...    32   0.99 
AY061006-1|AAL28554.1|  545|Drosophila melanogaster HL02140p pro...    32   0.99 
AF479079-1|AAL86452.1|  637|Drosophila melanogaster half pint pr...    32   0.99 
AF190745-1|AAF04132.1|  637|Drosophila melanogaster poly-U bindi...    32   0.99 
AE014297-3637|ABC66187.1|  392|Drosophila melanogaster CG6995-PC...    32   0.99 
AE014297-3636|AAF56343.3|  666|Drosophila melanogaster CG6995-PA...    32   0.99 
AE014297-3635|AAN14018.2|  928|Drosophila melanogaster CG6995-PB...    32   0.99 
AE014296-262|AAG22222.2|  545|Drosophila melanogaster CG12085-PD...    32   0.99 
AE014296-261|AAF47502.1|  545|Drosophila melanogaster CG12085-PC...    32   0.99 
AE014296-260|AAG22221.1|  545|Drosophila melanogaster CG12085-PB...    32   0.99 
AE014296-259|AAF47501.1|  637|Drosophila melanogaster CG12085-PA...    32   0.99 
S51695-1|AAB24625.1|   44|Drosophila melanogaster RNA recognitio...    31   1.3  
BT003653-1|AAO39657.1|  626|Drosophila melanogaster AT01548p pro...    31   1.7  
AY075220-1|AAL68087.1|  449|Drosophila melanogaster AT16577p pro...    31   1.7  
AE014297-2864|AAN13834.1|  529|Drosophila melanogaster CG17838-P...    31   1.7  
AE014297-2863|AAN13833.1|  529|Drosophila melanogaster CG17838-P...    31   1.7  
AE014297-2862|AAF55805.2|  707|Drosophila melanogaster CG17838-P...    31   1.7  
AE014297-2861|AAN13831.1|  571|Drosophila melanogaster CG17838-P...    31   1.7  
AE014297-2858|AAN13832.2|  563|Drosophila melanogaster CG17838-P...    31   1.7  
AE013599-3557|AAF46969.1|  449|Drosophila melanogaster CG3162-PA...    31   1.7  
S51727-1|AAB24633.1|   44|Drosophila melanogaster RNA recognitio...    30   3.0  
BT003308-1|AAO25068.1|  459|Drosophila melanogaster GH07080p pro...    30   3.0  
BT001280-1|AAN71036.1|  370|Drosophila melanogaster AT07793p pro...    30   3.0  
AE014297-4654|AAF57078.1|  459|Drosophila melanogaster CG1340-PA...    30   3.0  
BT024190-1|ABC86252.1|  358|Drosophila melanogaster RH12113p pro...    30   4.0  
AE014298-2413|AAN09409.1|  324|Drosophila melanogaster CG4429-PB...    30   4.0  
AE014298-2412|AAF48616.1|  325|Drosophila melanogaster CG4429-PA...    30   4.0  
AE014298-2411|AAS65388.1|  358|Drosophila melanogaster CG4429-PC...    30   4.0  
BT015266-1|AAT94495.1|  459|Drosophila melanogaster LD33831p pro...    29   5.3  
AY071474-1|AAL49096.1|  390|Drosophila melanogaster RE54950p pro...    29   5.3  
X62599-1|CAA44483.1|  376|Drosophila melanogaster 52-kD bracketi...    29   9.2  
X58720-1|CAA41556.1|  350|Drosophila melanogaster SRp55 protein.       29   9.2  
L34934-1|AAA73522.1|  224|Drosophila melanogaster RNA binding pr...    29   9.2  
BT011006-1|AAR27877.1|  690|Drosophila melanogaster AT27578p pro...    29   9.2  
BT003286-1|AAO25044.1|  350|Drosophila melanogaster GM10155p pro...    29   9.2  
BT003171-1|AAO24926.1|  443|Drosophila melanogaster SD07604p pro...    29   9.2  
BT001495-1|AAN71250.1|  350|Drosophila melanogaster LD30815p pro...    29   9.2  
BT001482-1|AAN71237.1|  187|Drosophila melanogaster LD22171p pro...    29   9.2  
BT001477-1|AAN71232.1|  443|Drosophila melanogaster LD21345p pro...    29   9.2  
AY113327-1|AAM29332.1|  350|Drosophila melanogaster AT29232p pro...    29   9.2  
AY075519-1|AAL68327.1|  224|Drosophila melanogaster RE69521p pro...    29   9.2  
AY070631-1|AAL48102.1|  224|Drosophila melanogaster RE74211p pro...    29   9.2  
AY058617-1|AAL13846.1|  690|Drosophila melanogaster LD31194p pro...    29   9.2  
AL023893-1|CAA19655.1|  485|Drosophila melanogaster EG:132E8.1 p...    29   9.2  
AF231031-1|AAF68949.1|  690|Drosophila melanogaster rasputin pro...    29   9.2  
AF116341-1|AAF00976.1|  224|Drosophila melanogaster poly(A)-bind...    29   9.2  
AE014298-190|AAS65244.1|  443|Drosophila melanogaster CG3056-PB,...    29   9.2  
AE014298-189|AAF45613.1|  485|Drosophila melanogaster CG3056-PA,...    29   9.2  
AE014297-1722|AAN13578.1|  147|Drosophila melanogaster CG10851-P...    29   9.2  
AE014297-1721|AAN13577.1|  135|Drosophila melanogaster CG10851-P...    29   9.2  
AE014297-1720|AAF54968.1|  329|Drosophila melanogaster CG10851-P...    29   9.2  
AE014297-1719|AAN13576.1|  346|Drosophila melanogaster CG10851-P...    29   9.2  
AE014297-1718|AAN13575.1|  350|Drosophila melanogaster CG10851-P...    29   9.2  
AE014297-1717|AAF54969.2|  350|Drosophila melanogaster CG10851-P...    29   9.2  
AE014297-1713|AAN13573.1|  690|Drosophila melanogaster CG9412-PE...    29   9.2  
AE014297-1712|AAN13572.1|  690|Drosophila melanogaster CG9412-PD...    29   9.2  
AE014297-1711|AAN13571.1|  690|Drosophila melanogaster CG9412-PC...    29   9.2  
AE014297-1710|AAG22151.2|  690|Drosophila melanogaster CG9412-PB...    29   9.2  
AE014297-1709|AAF54965.3|  690|Drosophila melanogaster CG9412-PA...    29   9.2  
AE014297-952|AAF54387.1|  632|Drosophila melanogaster CG9373-PA ...    29   9.2  
AE013599-599|AAM68852.1|  224|Drosophila melanogaster CG2163-PB,...    29   9.2  
AE013599-598|AAF59127.1|  224|Drosophila melanogaster CG2163-PA,...    29   9.2  

>X62636-1|CAA44502.1|  326|Drosophila melanogaster hrp36.1 protein.
          Length = 326

 Score =  143 bits (347), Expect = 2e-34
 Identities = 66/85 (77%), Positives = 73/85 (85%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDPKTKRS+GFGFITYSQ++M+D AQN RPHKIDGR VEPKRAVPR+EI 
Sbjct: 47  WGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEID 106

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV GL+ D +EE L
Sbjct: 107 SPNAGATVKKLFVGGLRDDHDEECL 131



 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 44/85 (51%), Positives = 57/85 (67%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FG IVSV++V+DK+TGKKRGF F+EFDDYDPVD++ LQ+ H IK   +
Sbjct: 126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTL 185

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRS 745
            + K    ++     G   RGGPR+
Sbjct: 186 DVKKAIAKQDMDRQGGGGGRGGPRA 210



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           + G++  EPE  RKLFIGGLDYRTTD  LK  +E
Sbjct: 12  DDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFE 45



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 17/61 (27%), Positives = 35/61 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IV V ++ D  T + +GF FI +     VD+    + H I  + ++ K+A+ ++++ 
Sbjct: 138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197

Query: 435 R 437
           R
Sbjct: 198 R 198



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ +F  +GNIV V V+ D +T + RGFGF+ +     +D     + H+I
Sbjct: 40  LKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89


>X59691-1|CAA42212.1|  386|Drosophila melanogaster P11 (hnRNP
           protein) protein.
          Length = 386

 Score =  143 bits (347), Expect = 2e-34
 Identities = 66/85 (77%), Positives = 73/85 (85%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDPKTKRS+GFGFITYSQ++M+D AQN RPHKIDGR VEPKRAVPR+EI 
Sbjct: 47  WGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEID 106

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV GL+ D +EE L
Sbjct: 107 SPNAGATVKKLFVGGLRDDHDEECL 131



 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 44/85 (51%), Positives = 57/85 (67%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FG IVSV++V+DK+TGKKRGF F+EFDDYDPVD++ LQ+ H IK   +
Sbjct: 126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTL 185

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRS 745
            + K    ++     G   RGGPR+
Sbjct: 186 DVKKAIAKQDMDRQGGGGGRGGPRA 210



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           + G++  EPE  RKLFIGGLDYRTTD  LK  +E
Sbjct: 12  DDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFE 45



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 17/61 (27%), Positives = 35/61 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IV V ++ D  T + +GF FI +     VD+    + H I  + ++ K+A+ ++++ 
Sbjct: 138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197

Query: 435 R 437
           R
Sbjct: 198 R 198



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ +F  +GNIV V V+ D +T + RGFGF+ +     +D     + H+I
Sbjct: 40  LKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89


>X58183-1|CAA41170.1|  386|Drosophila melanogaster heterogeneous
           nuclear ribonucleoproteinprotein.
          Length = 386

 Score =  143 bits (347), Expect = 2e-34
 Identities = 66/85 (77%), Positives = 73/85 (85%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDPKTKRS+GFGFITYSQ++M+D AQN RPHKIDGR VEPKRAVPR+EI 
Sbjct: 47  WGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEID 106

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV GL+ D +EE L
Sbjct: 107 SPNAGATVKKLFVGGLRDDHDEECL 131



 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 44/85 (51%), Positives = 57/85 (67%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FG IVSV++V+DK+TGKKRGF F+EFDDYDPVD++ LQ+ H IK   +
Sbjct: 126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTL 185

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRS 745
            + K    ++     G   RGGPR+
Sbjct: 186 DVKKAIAKQDMDRQGGGGGRGGPRA 210



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           + G++  EPE  RKLFIGGLDYRTTD  LK  +E
Sbjct: 12  DDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFE 45



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 17/61 (27%), Positives = 35/61 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IV V ++ D  T + +GF FI +     VD+    + H I  + ++ K+A+ ++++ 
Sbjct: 138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197

Query: 435 R 437
           R
Sbjct: 198 R 198



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ +F  +GNIV V V+ D +T + RGFGF+ +     +D     + H+I
Sbjct: 40  LKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89


>X54803-1|CAA38574.1|  386|Drosophila melanogaster Hrb87F protein.
          Length = 386

 Score =  143 bits (347), Expect = 2e-34
 Identities = 66/85 (77%), Positives = 73/85 (85%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDPKTKRS+GFGFITYSQ++M+D AQN RPHKIDGR VEPKRAVPR+EI 
Sbjct: 47  WGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEID 106

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV GL+ D +EE L
Sbjct: 107 SPNAGATVKKLFVGGLRDDHDEECL 131



 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 44/85 (51%), Positives = 57/85 (67%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FG IVSV++V+DK+TGKKRGF F+EFDDYDPVD++ LQ+ H IK   +
Sbjct: 126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTL 185

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRS 745
            + K    ++     G   RGGPR+
Sbjct: 186 DVKKAIAKQDMDRQGGGGGRGGPRA 210



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           + G++  EPE  RKLFIGGLDYRTTD  LK  +E
Sbjct: 12  DDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFE 45



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 17/61 (27%), Positives = 35/61 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IV V ++ D  T + +GF FI +     VD+    + H I  + ++ K+A+ ++++ 
Sbjct: 138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197

Query: 435 R 437
           R
Sbjct: 198 R 198



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ +F  +GNIV V V+ D +T + RGFGF+ +     +D     + H+I
Sbjct: 40  LKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89


>BT012315-1|AAS77440.1|  385|Drosophila melanogaster LD32727p
           protein.
          Length = 385

 Score =  143 bits (347), Expect = 2e-34
 Identities = 66/85 (77%), Positives = 73/85 (85%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDPKTKRS+GFGFITYSQ++M+D AQN RPHKIDGR VEPKRAVPR+EI 
Sbjct: 47  WGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEID 106

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV GL+ D +EE L
Sbjct: 107 SPNAGATVKKLFVGGLRDDHDEECL 131



 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 44/85 (51%), Positives = 57/85 (67%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FG IVSV++V+DK+TGKKRGF F+EFDDYDPVD++ LQ+ H IK   +
Sbjct: 126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTL 185

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRS 745
            + K    ++     G   RGGPR+
Sbjct: 186 DVKKAIAKQDMDRQGGGGGRGGPRA 210



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           + G++  EPE  RKLFIGGLDYRTTD  LK  +E
Sbjct: 12  DDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFE 45



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 17/61 (27%), Positives = 35/61 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IV V ++ D  T + +GF FI +     VD+    + H I  + ++ K+A+ ++++ 
Sbjct: 138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197

Query: 435 R 437
           R
Sbjct: 198 R 198



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ +F  +GNIV V V+ D +T + RGFGF+ +     +D     + H+I
Sbjct: 40  LKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89


>AE014297-1716|AAF54967.1|  385|Drosophila melanogaster CG12749-PA,
           isoform A protein.
          Length = 385

 Score =  143 bits (347), Expect = 2e-34
 Identities = 66/85 (77%), Positives = 73/85 (85%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDPKTKRS+GFGFITYSQ++M+D AQN RPHKIDGR VEPKRAVPR+EI 
Sbjct: 47  WGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEID 106

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV GL+ D +EE L
Sbjct: 107 SPNAGATVKKLFVGGLRDDHDEECL 131



 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 44/85 (51%), Positives = 57/85 (67%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FG IVSV++V+DK+TGKKRGF F+EFDDYDPVD++ LQ+ H IK   +
Sbjct: 126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTL 185

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRS 745
            + K    ++     G   RGGPR+
Sbjct: 186 DVKKAIAKQDMDRQGGGGGRGGPRA 210



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           + G++  EPE  RKLFIGGLDYRTTD  LK  +E
Sbjct: 12  DDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFE 45



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 17/61 (27%), Positives = 35/61 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IV V ++ D  T + +GF FI +     VD+    + H I  + ++ K+A+ ++++ 
Sbjct: 138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197

Query: 435 R 437
           R
Sbjct: 198 R 198



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ +F  +GNIV V V+ D +T + RGFGF+ +     +D     + H+I
Sbjct: 40  LKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89


>AE014297-1715|AAN13574.1|  325|Drosophila melanogaster CG12749-PB,
           isoform B protein.
          Length = 325

 Score =  143 bits (347), Expect = 2e-34
 Identities = 66/85 (77%), Positives = 73/85 (85%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDPKTKRS+GFGFITYSQ++M+D AQN RPHKIDGR VEPKRAVPR+EI 
Sbjct: 47  WGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEID 106

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV GL+ D +EE L
Sbjct: 107 SPNAGATVKKLFVGGLRDDHDEECL 131



 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 44/85 (51%), Positives = 57/85 (67%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FG IVSV++V+DK+TGKKRGF F+EFDDYDPVD++ LQ+ H IK   +
Sbjct: 126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTL 185

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRS 745
            + K    ++     G   RGGPR+
Sbjct: 186 DVKKAIAKQDMDRQGGGGGRGGPRA 210



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           + G++  EPE  RKLFIGGLDYRTTD  LK  +E
Sbjct: 12  DDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFE 45



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 17/61 (27%), Positives = 35/61 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+IV V ++ D  T + +GF FI +     VD+    + H I  + ++ K+A+ ++++ 
Sbjct: 138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMD 197

Query: 435 R 437
           R
Sbjct: 198 R 198



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ +F  +GNIV V V+ D +T + RGFGF+ +     +D     + H+I
Sbjct: 40  LKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89


>M25545-4|AAA28621.1|  361|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 361

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 50  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 110 SPNAGATVKKLFVGALKDDHDEQSI 134



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 129 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 188

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 189 DV-KKALPKQNDQQGGGGGRGGPGGRAG 215



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 18  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 48



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 141 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 197



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 25  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 84

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 85  QKSRPHKI 92


>M25545-3|AAA28624.1|  365|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 365

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 54  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 113

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 114 SPNAGATVKKLFVGALKDDHDEQSI 138



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 133 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 192

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 193 DV-KKALPKQNDQQGGGGGRGGPGGRAG 219



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 22  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 52



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 145 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 201



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 29  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 88

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 89  QKSRPHKI 96


>M25545-2|AAA28623.1|  360|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 360

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 49  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 108

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 109 SPNAGATVKKLFVGALKDDHDEQSI 133



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 128 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 187

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 188 DV-KKALPKQNDQQGGGGGRGGPGGRAG 214



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/39 (61%), Positives = 27/39 (69%)
 Frame = +1

Query: 136 NMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           N +  E  D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 9   NGQNEEQDDSITEPEHMRKLFIGGLDYRTTDENLKAHFE 47



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 140 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 196



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 24  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 83

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 84  QKSRPHKI 91


>M25545-1|AAA28622.1|  364|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 364

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 53  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 112

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 113 SPNAGATVKKLFVGALKDDHDEQSI 137



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 132 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 191

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 192 DV-KKALPKQNDQQGGGGGRGGPGGRAG 218



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 21  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 51



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 144 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 200



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 28  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 87

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 88  QKSRPHKI 95


>M15766-1|AAA70426.1|  365|Drosophila melanogaster unknown protein
           protein.
          Length = 365

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 54  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 113

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 114 SPNAGATVKKLFVGALKDDHDEQSI 138



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 133 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 192

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 193 DV-KKALPKQNDQQGGGGGRGGPGGRAG 219



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 22  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 52



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 145 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 201



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 29  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 88

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 89  QKSRPHKI 96


>AY061448-1|AAL28996.1|  361|Drosophila melanogaster LD38464p
           protein.
          Length = 361

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 50  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 110 SPNAGATVKKLFVGALKDDHDEQSI 134



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 129 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 188

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 189 DV-KKALPKQNDQQGGGGGRGGPGGRAG 215



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 18  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 48



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 141 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 197



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 25  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 84

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 85  QKSRPHKI 92


>AE014297-4248|AAN14144.1|  361|Drosophila melanogaster CG9983-PF,
           isoform F protein.
          Length = 361

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 50  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 110 SPNAGATVKKLFVGALKDDHDEQSI 134



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 129 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 188

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 189 DV-KKALPKQNDQQGGGGGRGGPGGRAG 215



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 18  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 48



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 141 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 197



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 25  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 84

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 85  QKSRPHKI 92


>AE014297-4247|AAN14143.1|  361|Drosophila melanogaster CG9983-PD,
           isoform D protein.
          Length = 361

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 50  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 110 SPNAGATVKKLFVGALKDDHDEQSI 134



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 129 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 188

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 189 DV-KKALPKQNDQQGGGGGRGGPGGRAG 215



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 18  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 48



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 141 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 197



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 25  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 84

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 85  QKSRPHKI 92


>AE014297-4246|AAN14142.1|  365|Drosophila melanogaster CG9983-PC,
           isoform C protein.
          Length = 365

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 54  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 113

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 114 SPNAGATVKKLFVGALKDDHDEQSI 138



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 133 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 192

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 193 DV-KKALPKQNDQQGGGGGRGGPGGRAG 219



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 22  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 52



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 145 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 201



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 29  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 88

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 89  QKSRPHKI 96


>AE014297-4245|AAF56801.1|  365|Drosophila melanogaster CG9983-PB,
           isoform B protein.
          Length = 365

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 54  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 113

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 114 SPNAGATVKKLFVGALKDDHDEQSI 138



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 133 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 192

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 193 DV-KKALPKQNDQQGGGGGRGGPGGRAG 219



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 22  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 52



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 145 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 201



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 29  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 88

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 89  QKSRPHKI 96


>AE014297-4244|AAN14141.1|  360|Drosophila melanogaster CG9983-PE,
           isoform E protein.
          Length = 360

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 49  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 108

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 109 SPNAGATVKKLFVGALKDDHDEQSI 133



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 128 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 187

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 188 DV-KKALPKQNDQQGGGGGRGGPGGRAG 214



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/39 (61%), Positives = 27/39 (69%)
 Frame = +1

Query: 136 NMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           N +  E  D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 9   NGQNEEQDDSITEPEHMRKLFIGGLDYRTTDENLKAHFE 47



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 140 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 196



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 24  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 83

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 84  QKSRPHKI 91


>AE014297-4243|AAF56800.2|  364|Drosophila melanogaster CG9983-PA,
           isoform A protein.
          Length = 364

 Score =  138 bits (334), Expect = 8e-33
 Identities = 61/85 (71%), Positives = 72/85 (84%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG IVDVVVMKDP+TKRS+GFGFITYS + M+DEAQ +RPHKIDGR+VEPKRAVPR++I 
Sbjct: 53  WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDID 112

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P A ATVKKLFV  LK D +E+ +
Sbjct: 113 SPNAGATVKKLFVGALKDDHDEQSI 137



 Score = 89.8 bits (213), Expect = 4e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H  + +R+YF  FGNIV +++V DKETGKKRGF FVEFDDYDPVD+V LQ+ HQ+    +
Sbjct: 132 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMV 191

Query: 671 WM*KKPISEN*HVWAGVMIRGGPRSTRG 754
            + KK + +      G   RGGP    G
Sbjct: 192 DV-KKALPKQNDQQGGGGGRGGPGGRAG 218



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           D   EPEH RKLFIGGLDYRTTD +LK  +E
Sbjct: 21  DSITEPEHMRKLFIGGLDYRTTDENLKAHFE 51



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 17/57 (29%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G IVD+ ++ D +T + +GF F+ +     VD+    + H+++G++V+ K+A+P++
Sbjct: 144 FGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 200



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +2

Query: 452 HR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           H  K+     + R     L+ +F  +GNIV V V+ D  T + RGFGF+ +     +D  
Sbjct: 28  HMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA 87

Query: 632 CLQQNHQI 655
              + H+I
Sbjct: 88  QKSRPHKI 95


>L02106-2|AAA99872.1|  465|Drosophila melanogaster ribonucleoprotein
           protein.
          Length = 465

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>L02106-1|AAA99873.1|  471|Drosophila melanogaster ribonucleoprotein
           protein.
          Length = 471

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>BT001320-1|AAN71075.1|  434|Drosophila melanogaster AT15526p
           protein.
          Length = 434

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AE014297-4014|AAX53003.1|  434|Drosophila melanogaster CG6354-PE,
           isoform E protein.
          Length = 434

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AE014297-4013|AAX53002.1|  434|Drosophila melanogaster CG6354-PD,
           isoform D protein.
          Length = 434

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AE014297-4012|AAX53001.1|  471|Drosophila melanogaster CG6354-PI,
           isoform I protein.
          Length = 471

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AE014297-4011|AAX53000.1|  471|Drosophila melanogaster CG6354-PH,
           isoform H protein.
          Length = 471

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AE014297-4010|AAX52999.1|  471|Drosophila melanogaster CG6354-PF,
           isoform F protein.
          Length = 471

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AE014297-4009|AAF56633.1|  471|Drosophila melanogaster CG6354-PB,
           isoform B protein.
          Length = 471

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AE014297-4008|AAX52998.1|  465|Drosophila melanogaster CG6354-PG,
           isoform G protein.
          Length = 465

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AE014297-4007|AAX52997.1|  465|Drosophila melanogaster CG6354-PC,
           isoform C protein.
          Length = 465

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AE014297-4006|AAN14092.1|  465|Drosophila melanogaster CG6354-PA,
           isoform A protein.
          Length = 465

 Score =  113 bits (273), Expect = 2e-25
 Identities = 53/85 (62%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++VDVVVM+D  TKRS+GFGFITY+++ MVD AQ NRPH IDG+ VE KRA+PR E +
Sbjct: 55  WGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERE 114

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             E + +VKKLFV GLK + +EE L
Sbjct: 115 SRETNISVKKLFVGGLKDNHDEECL 139



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 35/60 (58%), Positives = 44/60 (73%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           H    LREYF  FGN+VSV ++TDK TGK+RGF FVEFDDYD VD+  L++ H IK  ++
Sbjct: 134 HDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV 193



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +1

Query: 160 DDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           DD  E EH RKLFIGGL   TT+ +LK FY
Sbjct: 23  DDICELEHLRKLFIGGLAPYTTEENLKLFY 52



 Score = 35.5 bits (78), Expect = 0.080
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+ ++  +G +V V V+ D  T + RGFGF+ +     VDR    + H I
Sbjct: 48  LKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97


>AY122226-1|AAM52738.1|  369|Drosophila melanogaster RE25373p
           protein.
          Length = 369

 Score = 79.4 bits (187), Expect = 5e-15
 Identities = 37/87 (42%), Positives = 55/87 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I + +VMKDP T+RS+GFGF+T+S  + VD+      H++DG+ V+PK A PR    
Sbjct: 52  YGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRR--A 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
            P+     KK+FV GL      ED++S
Sbjct: 110 HPKMVTRTKKIFVGGLSAPTTLEDVKS 136



 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 22/50 (44%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF  +G+I    V+ D  T + RGFGFV F D + VD+V  Q  H++
Sbjct: 45  LRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHEL 94



 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 23/64 (35%), Positives = 39/64 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G I D ++M D +T R +GFGF+T+    +VD+      H+I+ ++VE K+A
Sbjct: 134 VKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKA 193

Query: 414 VPRE 425
            P+E
Sbjct: 194 QPKE 197



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ YF  FG I    ++ DK+T + RGFGFV F   D VD+VC    H+I
Sbjct: 134 VKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEI 183



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           E P    K+FIGGL ++T+  SL++++
Sbjct: 23  EVPNDPGKMFIGGLSWQTSPESLRDYF 49


>AE014296-2876|AAF49366.3|  369|Drosophila melanogaster CG32169-PA
           protein.
          Length = 369

 Score = 79.4 bits (187), Expect = 5e-15
 Identities = 37/87 (42%), Positives = 55/87 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I + +VMKDP T+RS+GFGF+T+S  + VD+      H++DG+ V+PK A PR    
Sbjct: 52  YGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRR--A 109

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
            P+     KK+FV GL      ED++S
Sbjct: 110 HPKMVTRTKKIFVGGLSAPTTLEDVKS 136



 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 22/50 (44%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YF  +G+I    V+ D  T + RGFGFV F D + VD+V  Q  H++
Sbjct: 45  LRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHEL 94



 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 23/64 (35%), Positives = 39/64 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G I D ++M D +T R +GFGF+T+    +VD+      H+I+ ++VE K+A
Sbjct: 134 VKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKA 193

Query: 414 VPRE 425
            P+E
Sbjct: 194 QPKE 197



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ YF  FG I    ++ DK+T + RGFGFV F   D VD+VC    H+I
Sbjct: 134 VKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEI 183



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           E P    K+FIGGL ++T+  SL++++
Sbjct: 23  EVPNDPGKMFIGGLSWQTSPESLRDYF 49


>X79339-1|CAA55897.1|  606|Drosophila melanogaster musashi protein.
          Length = 606

 Score = 78.2 bits (184), Expect = 1e-14
 Identities = 35/94 (37%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + DV++MKDP T+RS+GFGFIT+ +   V++      H +DG+ ++PK A
Sbjct: 191 LKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHA 250

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            P+    RP  +   KK+FV G+ QD   E++++
Sbjct: 251 TPK---NRPRQANKTKKIFVGGVSQDTSAEEVKA 281



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++ YFS FG +    ++ D++T + RGFGFV F++ D VDRVC    H IK
Sbjct: 279 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIK 329



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + + V++ D +TKR +GFGF+T+    +VD       H I  + VE K+A
Sbjct: 279 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKA 338

Query: 414 VPREEIKRPEASATVKKLFVAGL 482
            P+E +  P A    K++ +  L
Sbjct: 339 QPKEAV-TPAAQLLQKRIMLGTL 360



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +L+EYF+ FG +  V ++ D  T + RGFGF+ F +   V++V
Sbjct: 190 KLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKV 232



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           PS SG    +P    KLF+GGL ++T+   LKE++
Sbjct: 162 PSLSGGSGSDPA-PGKLFVGGLSWQTSSDKLKEYF 195


>AY119171-1|AAM51031.1|  634|Drosophila melanogaster RH49436p
           protein.
          Length = 634

 Score = 78.2 bits (184), Expect = 1e-14
 Identities = 35/94 (37%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + DV++MKDP T+RS+GFGFIT+ +   V++      H +DG+ ++PK A
Sbjct: 219 LKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHA 278

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            P+    RP  +   KK+FV G+ QD   E++++
Sbjct: 279 TPK---NRPRQANKTKKIFVGGVSQDTSAEEVKA 309



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++ YFS FG +    ++ D++T + RGFGFV F++ D VDRVC    H IK
Sbjct: 307 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIK 357



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + + V++ D +TKR +GFGF+T+    +VD       H I  + VE K+A
Sbjct: 307 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKA 366

Query: 414 VPREEIKRPEASATVKKLFVAGL 482
            P+E +  P A    K++ +  L
Sbjct: 367 QPKEAV-TPAAQLLQKRIMLGTL 388



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +L+EYF+ FG +  V ++ D  T + RGFGF+ F +   V++V
Sbjct: 218 KLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKV 260



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           PS SG    +P    KLF+GGL ++T+   LKE++
Sbjct: 190 PSLSGGSGSDPA-PGKLFVGGLSWQTSSDKLKEYF 223


>AY051802-1|AAK93226.1|  606|Drosophila melanogaster LD31631p
           protein.
          Length = 606

 Score = 78.2 bits (184), Expect = 1e-14
 Identities = 35/94 (37%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + DV++MKDP T+RS+GFGFIT+ +   V++      H +DG+ ++PK A
Sbjct: 191 LKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHA 250

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            P+    RP  +   KK+FV G+ QD   E++++
Sbjct: 251 TPK---NRPRQANKTKKIFVGGVSQDTSAEEVKA 281



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++ YFS FG +    ++ D++T + RGFGFV F++ D VDRVC    H IK
Sbjct: 279 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIK 329



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + + V++ D +TKR +GFGF+T+    +VD       H I  + VE K+A
Sbjct: 279 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKA 338

Query: 414 VPREEIKRPEASATVKKLFVAGL 482
            P+E +  P A    K++ +  L
Sbjct: 339 QPKEAV-TPAAQLLQKRIMLGTL 360



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +L+EYF+ FG +  V ++ D  T + RGFGF+ F +   V++V
Sbjct: 190 KLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKV 232



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           PS SG    +P    KLF+GGL ++T+   LKE++
Sbjct: 162 PSLSGGSGSDPA-PGKLFVGGLSWQTSSDKLKEYF 195


>AE014297-3816|AAF56478.2|  606|Drosophila melanogaster CG5099-PA,
           isoform A protein.
          Length = 606

 Score = 78.2 bits (184), Expect = 1e-14
 Identities = 35/94 (37%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + DV++MKDP T+RS+GFGFIT+ +   V++      H +DG+ ++PK A
Sbjct: 191 LKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHA 250

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            P+    RP  +   KK+FV G+ QD   E++++
Sbjct: 251 TPK---NRPRQANKTKKIFVGGVSQDTSAEEVKA 281



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++ YFS FG +    ++ D++T + RGFGFV F++ D VDRVC    H IK
Sbjct: 279 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIK 329



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + + V++ D +TKR +GFGF+T+    +VD       H I  + VE K+A
Sbjct: 279 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKA 338

Query: 414 VPREEIKRPEASATVKKLFVAGL 482
            P+E +  P A    K++ +  L
Sbjct: 339 QPKEAV-TPAAQLLQKRIMLGTL 360



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +L+EYF+ FG +  V ++ D  T + RGFGF+ F +   V++V
Sbjct: 190 KLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKV 232



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           PS SG    +P    KLF+GGL ++T+   LKE++
Sbjct: 162 PSLSGGSGSDPA-PGKLFVGGLSWQTSSDKLKEYF 195


>AE014297-3812|AAN14056.2|  634|Drosophila melanogaster CG5099-PB,
           isoform B protein.
          Length = 634

 Score = 78.2 bits (184), Expect = 1e-14
 Identities = 35/94 (37%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + DV++MKDP T+RS+GFGFIT+ +   V++      H +DG+ ++PK A
Sbjct: 219 LKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHA 278

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            P+    RP  +   KK+FV G+ QD   E++++
Sbjct: 279 TPK---NRPRQANKTKKIFVGGVSQDTSAEEVKA 309



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++ YFS FG +    ++ D++T + RGFGFV F++ D VDRVC    H IK
Sbjct: 307 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIK 357



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +G + + V++ D +TKR +GFGF+T+    +VD       H I  + VE K+A
Sbjct: 307 VKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKA 366

Query: 414 VPREEIKRPEASATVKKLFVAGL 482
            P+E +  P A    K++ +  L
Sbjct: 367 QPKEAV-TPAAQLLQKRIMLGTL 388



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +L+EYF+ FG +  V ++ D  T + RGFGF+ F +   V++V
Sbjct: 218 KLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKV 260



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           PS SG    +P    KLF+GGL ++T+   LKE++
Sbjct: 190 PSLSGGSGSDPA-PGKLFVGGLSWQTSSDKLKEYF 223


>X62639-1|CAA44505.1|  385|Drosophila melanogaster hrp48.1 protein.
          Length = 385

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 34/94 (36%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           + R    +G+I+D VVMK+ ++ RS+GFGF+T++    V+    N PH +DGR ++PK  
Sbjct: 23  LSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPC 82

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            PR  +++P+      K+F+ GL  ++ E DL +
Sbjct: 83  NPR-TLQKPKKGGGY-KVFLGGLPSNVTETDLRT 114



 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 21/57 (36%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G++ +VV+M D + K+S+GFGF+++ +   V+   N R   ++G+ VE K+A PR+
Sbjct: 119 YGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRD 175



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +  L  YF  FG+I+   V+ + E+G+ RGFGFV F D   V+ V     H +
Sbjct: 20  QENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTL 72



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR +F+ +G +  V ++ D+E  K RGFGF+ F++   V+ V
Sbjct: 112 LRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHV 153


>DQ062784-1|AAY56657.1|  421|Drosophila melanogaster heterogeneous
           nuclear ribonucleoproteinprotein.
          Length = 421

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 34/94 (36%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           + R    +G+I+D VVMK+ ++ RS+GFGF+T++    V+    N PH +DGR ++PK  
Sbjct: 23  LSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPC 82

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            PR  +++P+      K+F+ GL  ++ E DL +
Sbjct: 83  NPR-TLQKPKKGGGY-KVFLGGLPSNVTETDLRT 114



 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 21/57 (36%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G++ +VV+M D + K+S+GFGF+++ +   V+   N R   ++G+ VE K+A PR+
Sbjct: 119 YGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRD 175



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +  L  YF  FG+I+   V+ + E+G+ RGFGFV F D   V+ V     H +
Sbjct: 20  QENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTL 72



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR +F+ +G +  V ++ D+E  K RGFGF+ F++   V+ V
Sbjct: 112 LRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHV 153


>AY128430-1|AAM75023.1|  421|Drosophila melanogaster GH26816p
           protein.
          Length = 421

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 34/94 (36%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           + R    +G+I+D VVMK+ ++ RS+GFGF+T++    V+    N PH +DGR ++PK  
Sbjct: 23  LSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPC 82

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            PR  +++P+      K+F+ GL  ++ E DL +
Sbjct: 83  NPR-TLQKPKKGGGY-KVFLGGLPSNVTETDLRT 114



 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 21/57 (36%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G++ +VV+M D + K+S+GFGF+++ +   V+   N R   ++G+ VE K+A PR+
Sbjct: 119 YGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRD 175



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +  L  YF  FG+I+   V+ + E+G+ RGFGFV F D   V+ V     H +
Sbjct: 20  QENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTL 72



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR +F+ +G +  V ++ D+E  K RGFGF+ F++   V+ V
Sbjct: 112 LRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHV 153


>AY069699-1|AAL39844.1|  421|Drosophila melanogaster LD46853p
           protein.
          Length = 421

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 34/94 (36%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           + R    +G+I+D VVMK+ ++ RS+GFGF+T++    V+    N PH +DGR ++PK  
Sbjct: 23  LSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPC 82

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            PR  +++P+      K+F+ GL  ++ E DL +
Sbjct: 83  NPR-TLQKPKKGGGY-KVFLGGLPSNVTETDLRT 114



 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 21/57 (36%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G++ +VV+M D + K+S+GFGF+++ +   V+   N R   ++G+ VE K+A PR+
Sbjct: 119 YGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRD 175



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +  L  YF  FG+I+   V+ + E+G+ RGFGFV F D   V+ V     H +
Sbjct: 20  QENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTL 72



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR +F+ +G +  V ++ D+E  K RGFGF+ F++   V+ V
Sbjct: 112 LRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHV 153


>AE014134-1193|AAN10605.1|  421|Drosophila melanogaster CG10377-PC,
           isoform C protein.
          Length = 421

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 34/94 (36%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           + R    +G+I+D VVMK+ ++ RS+GFGF+T++    V+    N PH +DGR ++PK  
Sbjct: 23  LSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPC 82

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            PR  +++P+      K+F+ GL  ++ E DL +
Sbjct: 83  NPR-TLQKPKKGGGY-KVFLGGLPSNVTETDLRT 114



 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 21/57 (36%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G++ +VV+M D + K+S+GFGF+++ +   V+   N R   ++G+ VE K+A PR+
Sbjct: 119 YGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRD 175



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +  L  YF  FG+I+   V+ + E+G+ RGFGFV F D   V+ V     H +
Sbjct: 20  QENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTL 72



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR +F+ +G +  V ++ D+E  K RGFGF+ F++   V+ V
Sbjct: 112 LRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHV 153


>AE014134-1192|AAF52457.1|  421|Drosophila melanogaster CG10377-PB,
           isoform B protein.
          Length = 421

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 34/94 (36%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           + R    +G+I+D VVMK+ ++ RS+GFGF+T++    V+    N PH +DGR ++PK  
Sbjct: 23  LSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPC 82

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            PR  +++P+      K+F+ GL  ++ E DL +
Sbjct: 83  NPR-TLQKPKKGGGY-KVFLGGLPSNVTETDLRT 114



 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 21/57 (36%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G++ +VV+M D + K+S+GFGF+++ +   V+   N R   ++G+ VE K+A PR+
Sbjct: 119 YGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRD 175



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +  L  YF  FG+I+   V+ + E+G+ RGFGFV F D   V+ V     H +
Sbjct: 20  QENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTL 72



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR +F+ +G +  V ++ D+E  K RGFGF+ F++   V+ V
Sbjct: 112 LRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHV 153


>AE014134-1191|AAF52456.1|  421|Drosophila melanogaster CG10377-PA,
           isoform A protein.
          Length = 421

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 34/94 (36%), Positives = 58/94 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           + R    +G+I+D VVMK+ ++ RS+GFGF+T++    V+    N PH +DGR ++PK  
Sbjct: 23  LSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPC 82

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515
            PR  +++P+      K+F+ GL  ++ E DL +
Sbjct: 83  NPR-TLQKPKKGGGY-KVFLGGLPSNVTETDLRT 114



 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 21/57 (36%), Positives = 39/57 (68%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G++ +VV+M D + K+S+GFGF+++ +   V+   N R   ++G+ VE K+A PR+
Sbjct: 119 YGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRD 175



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +  L  YF  FG+I+   V+ + E+G+ RGFGFV F D   V+ V     H +
Sbjct: 20  QENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTL 72



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           LR +F+ +G +  V ++ D+E  K RGFGF+ F++   V+ V
Sbjct: 112 LRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHV 153


>U18401-1|AAC47508.1|  428|Drosophila melanogaster
           testis-specific-RRM-protein protein.
          Length = 428

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/61 (47%), Positives = 41/61 (67%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G + D VV++DP +  S+GFGF+TY     V+  Q  RPH ID +IVE K A+PR++ K
Sbjct: 55  FGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFK 114

Query: 435 R 437
           R
Sbjct: 115 R 115



 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    +REYFS FG + SV ++ D+ETG++R FGF+EF D    ++    + H I
Sbjct: 147 HDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWI 201



 Score = 36.3 bits (80), Expect = 0.046
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +FS FG +    V+ D  +   RGFGFV + D   V+ V   + H I
Sbjct: 48  LRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +G +  V ++ D +T R + FGF+ +      ++A   R H I   +VE KR+  + +
Sbjct: 159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 178 EHTRKLFIGGLDYRTTDSSLKEFY 249
           EH RK+FIGGL  +TT  +L+ F+
Sbjct: 29  EHLRKIFIGGLSTQTTVETLRGFF 52


>AY089457-1|AAL90195.1|  428|Drosophila melanogaster AT27014p
           protein.
          Length = 428

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/61 (47%), Positives = 41/61 (67%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G + D VV++DP +  S+GFGF+TY     V+  Q  RPH ID +IVE K A+PR++ K
Sbjct: 55  FGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFK 114

Query: 435 R 437
           R
Sbjct: 115 R 115



 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    +REYFS FG + SV ++ D+ETG++R FGF+EF D    ++    + H I
Sbjct: 147 HDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWI 201



 Score = 36.3 bits (80), Expect = 0.046
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +FS FG +    V+ D  +   RGFGFV + D   V+ V   + H I
Sbjct: 48  LRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +G +  V ++ D +T R + FGF+ +      ++A   R H I   +VE KR+  + +
Sbjct: 159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 178 EHTRKLFIGGLDYRTTDSSLKEFY 249
           EH RK+FIGGL  +TT  +L+ F+
Sbjct: 29  EHLRKIFIGGLSTQTTVETLRGFF 52


>AE014297-1714|AAF54966.1|  428|Drosophila melanogaster CG9654-PA
           protein.
          Length = 428

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/61 (47%), Positives = 41/61 (67%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G + D VV++DP +  S+GFGF+TY     V+  Q  RPH ID +IVE K A+PR++ K
Sbjct: 55  FGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFK 114

Query: 435 R 437
           R
Sbjct: 115 R 115



 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +2

Query: 491 H*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           H    +REYFS FG + SV ++ D+ETG++R FGF+EF D    ++    + H I
Sbjct: 147 HDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWI 201



 Score = 36.3 bits (80), Expect = 0.046
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +FS FG +    V+ D  +   RGFGFV + D   V+ V   + H I
Sbjct: 48  LRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTI 97



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           +G +  V ++ D +T R + FGF+ +      ++A   R H I   +VE KR+  + +
Sbjct: 159 FGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKAD 216



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 178 EHTRKLFIGGLDYRTTDSSLKEFY 249
           EH RK+FIGGL  +TT  +L+ F+
Sbjct: 29  EHLRKIFIGGLSTQTTVETLRGFF 52


>X62638-1|CAA44504.1|  345|Drosophila melanogaster hrp40.2 protein.
          Length = 345

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 187 RKLFIGGLDYRTTDSSLKE-FYEHGE 261
           RKLF+GGL + TT+  L++ F ++GE
Sbjct: 56  RKLFVGGLSWETTEKELRDHFGKYGE 81


>X62637-1|CAA44503.1|  321|Drosophila melanogaster hrp40.1 protein.
          Length = 321

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 187 RKLFIGGLDYRTTDSSLKE-FYEHGE 261
           RKLF+GGL + TT+  L++ F ++GE
Sbjct: 56  RKLFVGGLSWETTEKELRDHFGKYGE 81


>S62100-1|AAB26989.1|  308|Drosophila melanogaster SqdB protein.
          Length = 308

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 187 RKLFIGGLDYRTTDSSLKE-FYEHGE 261
           RKLF+GGL + TT+  L++ F ++GE
Sbjct: 56  RKLFVGGLSWETTEKELRDHFGKYGE 81


>S61875-1|AAB26988.1|  321|Drosophila melanogaster SqdA protein.
          Length = 321

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 187 RKLFIGGLDYRTTDSSLKE-FYEHGE 261
           RKLF+GGL + TT+  L++ F ++GE
Sbjct: 56  RKLFVGGLSWETTEKELRDHFGKYGE 81


>BT023832-1|AAZ86753.1|  308|Drosophila melanogaster LD29474p
           protein.
          Length = 308

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 187 RKLFIGGLDYRTTDSSLKE-FYEHGE 261
           RKLF+GGL + TT+  L++ F ++GE
Sbjct: 56  RKLFVGGLSWETTEKELRDHFGKYGE 81


>AY118501-1|AAM49870.1|  321|Drosophila melanogaster LD09691p
           protein.
          Length = 321

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 187 RKLFIGGLDYRTTDSSLKE-FYEHGE 261
           RKLF+GGL + TT+  L++ F ++GE
Sbjct: 56  RKLFVGGLSWETTEKELRDHFGKYGE 81


>AE014297-1708|AAF54964.2|  321|Drosophila melanogaster CG16901-PA,
           isoform A protein.
          Length = 321

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 187 RKLFIGGLDYRTTDSSLKE-FYEHGE 261
           RKLF+GGL + TT+  L++ F ++GE
Sbjct: 56  RKLFVGGLSWETTEKELRDHFGKYGE 81


>AE014297-1706|AAF54963.2|  344|Drosophila melanogaster CG16901-PB,
           isoform B protein.
          Length = 344

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 187 RKLFIGGLDYRTTDSSLKE-FYEHGE 261
           RKLF+GGL + TT+  L++ F ++GE
Sbjct: 56  RKLFVGGLSWETTEKELRDHFGKYGE 81


>AE014297-1705|AAN13570.1|  308|Drosophila melanogaster CG16901-PC,
           isoform C protein.
          Length = 308

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI  + V  DP+T RS+GF FI ++    +D+      H I+ + V+PK+A  R    
Sbjct: 79  YGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH--- 135

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
                    K+FV GL  +I +E++++
Sbjct: 136 --------GKIFVGGLTTEISDEEIKT 154



 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + LR++F  +G I S++V TD +TG+ RGF F+ F + + +D+V     H I
Sbjct: 70  KELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHII 121



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK     +G IV+V +  D +  + KGF FIT+    +V +       KI G+ V+ KRA
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 414 VPREE 428
            P+ E
Sbjct: 212 TPKPE 216



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*K- 682
           ++ YF  FGNIV V +  DK+  +++GF F+ FD    V  +      +I    + + + 
Sbjct: 152 IKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRA 211

Query: 683 KPISEN*HVWAGVMIRGGPR-STRGVR 760
            P  EN  +  G  +RGGPR   RG R
Sbjct: 212 TPKPEN-QMMGG--MRGGPRGGMRGGR 235



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 187 RKLFIGGLDYRTTDSSLKE-FYEHGE 261
           RKLF+GGL + TT+  L++ F ++GE
Sbjct: 56  RKLFVGGLSWETTEKELRDHFGKYGE 81


>AE014298-3112|AAN09672.1|   90|Drosophila melanogaster CG33714-PB,
           isoform B protein.
          Length = 90

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           + LR YF  FG +VS +V+ DK TG  +G+GFV F+    ++++  +Q H
Sbjct: 29  QELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKH 78



 Score = 36.7 bits (81), Expect = 0.035
 Identities = 13/53 (24%), Positives = 33/53 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G +V   V+ D +T  SKG+GF++++    +++ +N + H ++G  +  +++
Sbjct: 38  FGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHILEGNYLNIQKS 90


>AE014298-3111|AAN09673.1|   90|Drosophila melanogaster CG33714-PA,
           isoform A protein.
          Length = 90

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           + LR YF  FG +VS +V+ DK TG  +G+GFV F+    ++++  +Q H
Sbjct: 29  QELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKH 78



 Score = 36.7 bits (81), Expect = 0.035
 Identities = 13/53 (24%), Positives = 33/53 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G +V   V+ D +T  SKG+GF++++    +++ +N + H ++G  +  +++
Sbjct: 38  FGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHILEGNYLNIQKS 90


>AY118452-1|AAM49821.1|  318|Drosophila melanogaster AT09813p
           protein.
          Length = 318

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 22/50 (44%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G++V   +  D  +G  +GFGFV F  YD V    L + H I
Sbjct: 123 LREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYD-VQMHVLSKRHSI 171



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 29/85 (34%), Positives = 43/85 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G++V   + KD ++  SKGFGF+ +    +     + R H IDGR  E K  VP     
Sbjct: 130 YGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKR-HSIDGRWCEVK--VP---AS 183

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           R   +    K+FV    +DIE +DL
Sbjct: 184 RGMGNQEPGKVFVGRCTEDIEADDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF-DDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG ++ V +         R F FV F D Y P  RV   + H IK  ++
Sbjct: 208 LREYFSKFGEVIDVFI-----PKPFRAFSFVTFLDPYVP--RVVCGEKHIIKGVSV 256


>AE014296-2502|AAF49643.2|  318|Drosophila melanogaster CG7804-PA
           protein.
          Length = 318

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 22/50 (44%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G++V   +  D  +G  +GFGFV F  YD V    L + H I
Sbjct: 123 LREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYD-VQMHVLSKRHSI 171



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 29/85 (34%), Positives = 43/85 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G++V   + KD ++  SKGFGF+ +    +     + R H IDGR  E K  VP     
Sbjct: 130 YGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKR-HSIDGRWCEVK--VP---AS 183

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           R   +    K+FV    +DIE +DL
Sbjct: 184 RGMGNQEPGKVFVGRCTEDIEADDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF-DDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG ++ V +         R F FV F D Y P  RV   + H IK  ++
Sbjct: 208 LREYFSKFGEVIDVFI-----PKPFRAFSFVTFLDPYVP--RVVCGEKHIIKGVSV 256


>BT022083-1|AAY33499.1|  531|Drosophila melanogaster RH39704p
           protein.
          Length = 531

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AY089497-1|AAL90235.1|  531|Drosophila melanogaster GH09868p
           protein.
          Length = 531

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AE013599-3707|AAF47080.2|  332|Drosophila melanogaster CG10327-PA,
           isoform A protein.
          Length = 332

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AE013599-3706|AAM68274.1|  531|Drosophila melanogaster CG10327-PD,
           isoform D protein.
          Length = 531

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AE013599-3705|AAF47078.2|  531|Drosophila melanogaster CG10327-PC,
           isoform C protein.
          Length = 531

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AE013599-3704|AAF47079.2|  531|Drosophila melanogaster CG10327-PB,
           isoform B protein.
          Length = 531

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AB019707-1|BAA34430.1|  332|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 332

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AB019706-1|BAA34429.1|  531|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 531

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AB019705-1|BAA34428.1|  531|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 531

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AB010261-8|BAA34422.1|  332|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 332

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>AB010261-7|BAA34421.1|  531|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 531

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF T+G ++   +  D ++G+ +GFGFV F  YD   RV L   H I
Sbjct: 123 LREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV-LTNRHLI 171



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++   + KD K+ +SKGFGF+ +           NR H IDGR  E K  VP  +  
Sbjct: 130 YGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNR-HLIDGRWCEVK--VPNSKGM 186

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +      K+FV    +DI  +DL
Sbjct: 187 GHQVPC---KVFVGRCTEDINSDDL 208



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LREYFS FG +  V +         R F FV F D D    +C  ++H IK  ++
Sbjct: 208 LREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLC-GEDHIIKGVSV 256


>BT003274-1|AAO25031.1|  313|Drosophila melanogaster LD15419p
           protein.
          Length = 313

 Score = 46.0 bits (104), Expect = 6e-05
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATV 458
           ++ D +TKR +GFGF+T+    +VD       H I  + VE K+A P+E +  P A    
Sbjct: 1   MLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAV-TPAAQLLQ 59

Query: 459 KKLFVAGL 482
           K++ +  L
Sbjct: 60  KRIMLGTL 67



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 18/36 (50%), Positives = 25/36 (69%)
 Frame = +2

Query: 551 VVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           ++ D++T + RGFGFV F++ D VDRVC    H IK
Sbjct: 1   MLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIK 36


>BT004860-1|AAO45216.1|  437|Drosophila melanogaster RE27227p
           protein.
          Length = 437

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L+E FS  G ++S+ +V D+E+GK +GFGF E+ D +
Sbjct: 31  KLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQE 68


>AF170082-1|AAD47839.1|  419|Drosophila melanogaster cleavage
           stimulation factor 64kilodalton subunit protein.
          Length = 419

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L+E FS  G ++S+ +V D+E+GK +GFGF E+ D +
Sbjct: 31  KLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQE 68


>AE014297-2555|AAF55577.2|  419|Drosophila melanogaster CG7697-PA
           protein.
          Length = 419

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L+E FS  G ++S+ +V D+E+GK +GFGF E+ D +
Sbjct: 31  KLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQE 68


>L05109-1|AAA70421.1|  632|Drosophila melanogaster poly(A)-binding
           protein protein.
          Length = 632

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 300 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 333



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 196 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 229



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AY118528-1|AAM49897.1|  634|Drosophila melanogaster LD24412p
           protein.
          Length = 634

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 302 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 335



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 198 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 231



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AE014297-773|AAF54259.1|   91|Drosophila melanogaster CG8021-PA
           protein.
          Length = 91

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           + LR YFS +G++ +  VV D++ G  + +GFV F   D  +    Q  H
Sbjct: 24  KELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTH 73



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 17/53 (32%), Positives = 30/53 (56%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G + +  V+ D +   SK +GF+ +SQ    + A N   H +DGR++  +RA
Sbjct: 33  YGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHFLDGRVLTVQRA 85


>AE013599-2628|AAS64811.1|  634|Drosophila melanogaster CG5119-PH,
           isoform H protein.
          Length = 634

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 302 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 335



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 198 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 231



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AE013599-2627|AAM68178.1|  634|Drosophila melanogaster CG5119-PG,
           isoform G protein.
          Length = 634

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 302 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 335



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 198 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 231



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AE013599-2626|AAF57747.1|  634|Drosophila melanogaster CG5119-PF,
           isoform F protein.
          Length = 634

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 302 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 335



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 198 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 231



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AE013599-2625|AAM68177.1|  634|Drosophila melanogaster CG5119-PE,
           isoform E protein.
          Length = 634

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 302 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 335



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 198 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 231



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AE013599-2624|AAM68176.1|  634|Drosophila melanogaster CG5119-PD,
           isoform D protein.
          Length = 634

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 302 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 335



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 198 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 231



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AE013599-2623|AAF57746.1|  634|Drosophila melanogaster CG5119-PC,
           isoform C protein.
          Length = 634

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 302 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 335



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 198 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 231



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AE013599-2622|AAF57745.1|  634|Drosophila melanogaster CG5119-PB,
           isoform B protein.
          Length = 634

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 302 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 335



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 198 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 231



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AE013599-2621|AAM68175.1|  634|Drosophila melanogaster CG5119-PA,
           isoform A protein.
          Length = 634

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           RLR  FS +GNI S  V+TD+E G+ +GFGFV F+
Sbjct: 302 RLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFN 335



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +L+E+F  +G I S  V++ KE GK +GFGFV F+
Sbjct: 198 KLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFE 231



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + + + FS FGNI+S  V TD E G  +G+GFV F+
Sbjct: 104 KAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFE 138


>AY051860-1|AAK93284.1|  594|Drosophila melanogaster LD35730p
           protein.
          Length = 594

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D ETG+ +G+GF+ + + D   +   Q N
Sbjct: 351 LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLN 397



 Score = 38.3 bits (85), Expect = 0.011
 Identities = 18/53 (33%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C     R   R L E+FS+ G +  V ++T  +T + +G  ++EFDD + V
Sbjct: 239 VFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESV 291



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           ++ I   +G+I  + ++ D +T RSKG+GFITY   H  D+A+
Sbjct: 351 LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITY---HNADDAK 390


>AE014134-1228|AAN10619.1|  287|Drosophila melanogaster CG11266-PG,
           isoform G protein.
          Length = 287

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D ETG+ +G+GF+ + + D   +   Q N
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLN 90



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           ++ I   +G+I  + ++ D +T RSKG+GFITY   H  D+A+
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITY---HNADDAK 83


>AE014134-1227|AAN10618.1|  287|Drosophila melanogaster CG11266-PF,
           isoform F protein.
          Length = 287

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D ETG+ +G+GF+ + + D   +   Q N
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLN 90



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           ++ I   +G+I  + ++ D +T RSKG+GFITY   H  D+A+
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITY---HNADDAK 83


>AE014134-1226|AAN10615.2|  287|Drosophila melanogaster CG11266-PE,
           isoform E protein.
          Length = 287

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D ETG+ +G+GF+ + + D   +   Q N
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLN 90



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           ++ I   +G+I  + ++ D +T RSKG+GFITY   H  D+A+
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITY---HNADDAK 83


>AE014134-1225|AAN10617.1|  287|Drosophila melanogaster CG11266-PD,
           isoform D protein.
          Length = 287

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D ETG+ +G+GF+ + + D   +   Q N
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLN 90



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           ++ I   +G+I  + ++ D +T RSKG+GFITY   H  D+A+
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITY---HNADDAK 83


>AE014134-1224|AAN10616.1|  287|Drosophila melanogaster CG11266-PC,
           isoform C protein.
          Length = 287

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D ETG+ +G+GF+ + + D   +   Q N
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLN 90



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           ++ I   +G+I  + ++ D +T RSKG+GFITY   H  D+A+
Sbjct: 44  LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITY---HNADDAK 83


>AE014134-1223|AAN10614.1|  594|Drosophila melanogaster CG11266-PB,
           isoform B protein.
          Length = 594

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D ETG+ +G+GF+ + + D   +   Q N
Sbjct: 351 LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLN 397



 Score = 38.3 bits (85), Expect = 0.011
 Identities = 18/53 (33%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C     R   R L E+FS+ G +  V ++T  +T + +G  ++EFDD + V
Sbjct: 239 VFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESV 291



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           ++ I   +G+I  + ++ D +T RSKG+GFITY   H  D+A+
Sbjct: 351 LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITY---HNADDAK 390


>AE014134-1222|AAF52478.1|  594|Drosophila melanogaster CG11266-PA,
           isoform A protein.
          Length = 594

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D ETG+ +G+GF+ + + D   +   Q N
Sbjct: 351 LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLN 397



 Score = 38.3 bits (85), Expect = 0.011
 Identities = 18/53 (33%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C     R   R L E+FS+ G +  V ++T  +T + +G  ++EFDD + V
Sbjct: 239 VFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESV 291



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362
           ++ I   +G+I  + ++ D +T RSKG+GFITY   H  D+A+
Sbjct: 351 LRGIFEPFGKIDAIQLIMDTETGRSKGYGFITY---HNADDAK 390


>S51693-1|AAB24624.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           + LR++F  +G I +++V TD +TG+ RGF F+
Sbjct: 12  KELRDHFGKYGEIENINVKTDPQTGRSRGFAFI 44



 Score = 31.5 bits (68), Expect = 1.3
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFI 326
           +GEI ++ V  DP+T RS+GF FI
Sbjct: 21  YGEIENINVKTDPQTGRSRGFAFI 44


>BT001728-1|AAN71483.1|  470|Drosophila melanogaster RE70333p
           protein.
          Length = 470

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 15/36 (41%), Positives = 25/36 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY 613
           +RE FS +G++ SV++V +K  G  +GFG+V F  +
Sbjct: 138 IREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKF 173



 Score = 36.3 bits (80), Expect = 0.046
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA--VPREE 428
           WG++  V ++K+      KGFG++ +++ +    A  N   K      EPK +    R++
Sbjct: 145 WGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQRDQ 204

Query: 429 IKRP 440
             RP
Sbjct: 205 YGRP 208



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 15/47 (31%), Positives = 27/47 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI 395
           +GEI D+ V+KD  T+ +KG  ++ +S+     +AQ     K  G++
Sbjct: 50  YGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKM 96


>AE014296-817|AAF47879.2|  470|Drosophila melanogaster CG1316-PA
           protein.
          Length = 470

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 15/36 (41%), Positives = 25/36 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY 613
           +RE FS +G++ SV++V +K  G  +GFG+V F  +
Sbjct: 138 IREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKF 173



 Score = 36.3 bits (80), Expect = 0.046
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA--VPREE 428
           WG++  V ++K+      KGFG++ +++ +    A  N   K      EPK +    R++
Sbjct: 145 WGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQRDQ 204

Query: 429 IKRP 440
             RP
Sbjct: 205 YGRP 208



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 15/47 (31%), Positives = 27/47 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI 395
           +GEI D+ V+KD  T+ +KG  ++ +S+     +AQ     K  G++
Sbjct: 50  YGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKM 96


>S55886-1|AAB25519.2|  444|Drosophila melanogaster RRM9 protein.
          Length = 444

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 181

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 182 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 214



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 377 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 413



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 158



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 5/52 (9%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGK-----KRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  TG+      +G GF+ FD     DR   + N
Sbjct: 212 LESLFSPYGKIITSRILCDNITGEHAAGLSKGVGFIRFDQRFEADRAIKELN 263


>L04930-2|AAC13646.1|  439|Drosophila melanogaster RNA-binding
           protein protein.
          Length = 439

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 181

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 182 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 214



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  TG  +G GF+ FD     DR   + N
Sbjct: 212 LESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELN 258



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 372 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 408



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 158


>L04930-1|AAC13645.1|  444|Drosophila melanogaster RNA-binding
           protein protein.
          Length = 444

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 181

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 182 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 214



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 377 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 413



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 158



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 5/52 (9%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKET-----GKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  T     G  +G GF+ FD     DR   + N
Sbjct: 212 LESLFSPYGKIITSRILCDNITDEHAAGLSKGVGFIRFDQRFEADRAIKELN 263


>BT029936-1|ABM92810.1|  647|Drosophila melanogaster IP15810p
           protein.
          Length = 647

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 329 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 384

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 385 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 417



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 580 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 616



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 329 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 361



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 5/52 (9%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKET-----GKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  T     G  +G GF+ FD     DR   + N
Sbjct: 415 LESLFSPYGKIITSRILCDNITDEHAAGLSKGVGFIRFDQRFEADRAIKELN 466


>BT025832-1|ABF85732.1|  791|Drosophila melanogaster IP09238p
           protein.
          Length = 791

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 28/88 (31%), Positives = 39/88 (44%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM* 679
           ++LRE F+ FG I    VV D +T K +G+GFV F      +      N Q      W+ 
Sbjct: 466 QQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQ------WLG 519

Query: 680 KKPISEN*HVWAGVMIRGGPRSTRGVRP 763
            + I  N   WA    R  P S   ++P
Sbjct: 520 SRSIRTN---WA---TRKPPASKENIKP 541



 Score = 36.3 bits (80), Expect = 0.046
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +GEI D  V++DP+T +SKG+GF+++ +    + A
Sbjct: 475 FGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESA 509


>BT011197-1|AAR88559.1|  439|Drosophila melanogaster GH26440p
           protein.
          Length = 439

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 181

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 182 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 214



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  TG  +G GF+ FD     DR   + N
Sbjct: 212 LESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELN 258



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 372 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 408



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 158


>AY121663-1|AAM51990.1|  505|Drosophila melanogaster RE10833p
           protein.
          Length = 505

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 28/88 (31%), Positives = 39/88 (44%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM* 679
           ++LRE F+ FG I    VV D +T K +G+GFV F      +      N Q      W+ 
Sbjct: 180 QQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQ------WLG 233

Query: 680 KKPISEN*HVWAGVMIRGGPRSTRGVRP 763
            + I  N   WA    R  P S   ++P
Sbjct: 234 SRSIRTN---WA---TRKPPASKENIKP 255



 Score = 36.3 bits (80), Expect = 0.046
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +GEI D  V++DP+T +SKG+GF+++ +    + A
Sbjct: 189 FGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESA 223


>AE014297-4216|AAF56774.2|  505|Drosophila melanogaster CG12870-PA
           protein.
          Length = 505

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 28/88 (31%), Positives = 39/88 (44%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM* 679
           ++LRE F+ FG I    VV D +T K +G+GFV F      +      N Q      W+ 
Sbjct: 180 QQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQ------WLG 233

Query: 680 KKPISEN*HVWAGVMIRGGPRSTRGVRP 763
            + I  N   WA    R  P S   ++P
Sbjct: 234 SRSIRTN---WA---TRKPPASKENIKP 255



 Score = 36.3 bits (80), Expect = 0.046
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +GEI D  V++DP+T +SKG+GF+++ +    + A
Sbjct: 189 FGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESA 223


>AE014134-520|AAX52651.1|  439|Drosophila melanogaster CG3151-PG,
           isoform G protein.
          Length = 439

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 181

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 182 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 214



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  TG  +G GF+ FD     DR   + N
Sbjct: 212 LESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELN 258



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 372 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 408



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 158


>AE014134-519|AAN10403.1|  439|Drosophila melanogaster CG3151-PF,
           isoform F protein.
          Length = 439

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 181

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 182 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 214



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  TG  +G GF+ FD     DR   + N
Sbjct: 212 LESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELN 258



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 372 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 408



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 158


>AE014134-518|AAN10402.1|  439|Drosophila melanogaster CG3151-PE,
           isoform E protein.
          Length = 439

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 181

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 182 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 214



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  TG  +G GF+ FD     DR   + N
Sbjct: 212 LESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELN 258



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 372 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 408



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 158


>AE014134-517|AAF51178.2|  444|Drosophila melanogaster CG3151-PC,
           isoform C protein.
          Length = 444

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 181

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 182 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 214



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 377 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 413



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 158



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 5/52 (9%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKET-----GKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  T     G  +G GF+ FD     DR   + N
Sbjct: 212 LESLFSPYGKIITSRILCDNITDEHAAGLSKGVGFIRFDQRFEADRAIKELN 263


>AE014134-516|AAF51177.2|  444|Drosophila melanogaster CG3151-PB,
           isoform B protein.
          Length = 444

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 181

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 182 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 214



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 377 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 413



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 126 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 158



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 5/52 (9%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKET-----GKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  T     G  +G GF+ FD     DR   + N
Sbjct: 212 LESLFSPYGKIITSRILCDNITDEHAAGLSKGVGFIRFDQRFEADRAIKELN 263


>AE014134-515|AAN10401.2|  642|Drosophila melanogaster CG3151-PD,
           isoform D protein.
          Length = 642

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 329 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 384

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 385 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 417



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  TG  +G GF+ FD     DR   + N
Sbjct: 415 LESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELN 461



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 575 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 611



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 329 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 361


>AE014134-514|AAF51179.3|  647|Drosophila melanogaster CG3151-PA,
           isoform A protein.
          Length = 647

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+ +  ++GE+    +++D  T +S G+GF+ Y +    ++A N     ++G  ++ K  
Sbjct: 329 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAIN----ALNGLRLQNKTI 384

Query: 414 VPREEIKRPEASATVK--KLFVAGLKQDIEEEDLES 515
             +  I RP +S ++K   L+V+GL +++ + DLES
Sbjct: 385 --KVSIARP-SSESIKGANLYVSGLPKNMTQSDLES 417



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 580 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 616



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           +R  F +FG + S  ++ DK TG+  G+GFV +
Sbjct: 329 IRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNY 361



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 5/52 (9%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKET-----GKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  T     G  +G GF+ FD     DR   + N
Sbjct: 415 LESLFSPYGKIITSRILCDNITDEHAAGLSKGVGFIRFDQRFEADRAIKELN 466


>U73846-1|AAB61993.1|  808|Drosophila melanogaster testis-specific
           RNP-type RNA bindingprotein protein.
          Length = 808

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L   F  FGN++S  V  DK+T   + FGFV FD+ D
Sbjct: 740 LASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPD 776



 Score = 29.1 bits (62), Expect = 7.0
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEI 431
           +G +  + V++D  T  SKG  F+T+       +AQ+   + K    +  P +  P +  
Sbjct: 378 YGAVHSINVLRDKATGISKGCCFVTFYTRRAALKAQDALHNVKTLNGMYHPIQMKPADSE 437

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            R E     +KLFV  L + + E D+
Sbjct: 438 NRNE-----RKLFVGMLNKKLNENDV 458


>U58976-1|AAB58464.1|  604|Drosophila melanogaster bruno protein.
          Length = 604

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L   F  FGN++S  V  DK+T   + FGFV FD+ D
Sbjct: 536 LASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPD 572



 Score = 29.1 bits (62), Expect = 7.0
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEI 431
           +G +  + V++D  T  SKG  F+T+       +AQ+   + K    +  P +  P +  
Sbjct: 174 YGAVHSINVLRDKATGISKGCCFVTFYTRRAALKAQDALHNVKTLNGMYHPIQMKPADSE 233

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            R E     +KLFV  L + + E D+
Sbjct: 234 NRNE-----RKLFVGMLNKKLNENDV 254


>AY118847-1|AAM50707.1|  181|Drosophila melanogaster GM15173p
           protein.
          Length = 181

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L   F  FGN++S  V  DK+T   + FGFV FD+ D
Sbjct: 113 LASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPD 149


>AY071650-1|AAL49272.1|  361|Drosophila melanogaster RE72594p
           protein.
          Length = 361

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L   F  FGN++S  V  DK+T   + FGFV FD+ D
Sbjct: 293 LASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPD 329


>AY071293-1|AAL48915.1|  170|Drosophila melanogaster RE32504p
           protein.
          Length = 170

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/44 (38%), Positives = 27/44 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           ++LR+YF  FG ++ V +     TG  +G+ FVEF +Y  V +V
Sbjct: 65  QQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEF-EYPEVAKV 107


>AY051758-1|AAK93182.1|  604|Drosophila melanogaster LD29068p
           protein.
          Length = 604

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L   F  FGN++S  V  DK+T   + FGFV FD+ D
Sbjct: 536 LASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPD 572



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEI 431
           +G +  + V++D  T  SKG  F+T+   H   +AQ+   + K    +  P +  P +  
Sbjct: 174 YGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSE 233

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            R E     +KLFV  L + + E D+
Sbjct: 234 NRNE-----RKLFVGMLNKKLNENDV 254


>AF239667-1|AAF43091.1|  356|Drosophila melanogaster putative RNA
           binding protein protein.
          Length = 356

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D +T K +GFGFV   +YD
Sbjct: 289 LWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYD 325



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   F++FG I++  ++ D  +G  +G GF+ FD  +  +R   + N
Sbjct: 146 LEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELN 192



 Score = 29.5 bits (63), Expect = 5.3
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT 329
           +G +  V V++D +T + KGFGF+T
Sbjct: 296 FGAVQSVKVIRDLQTSKCKGFGFVT 320


>AE014298-1827|AAF48215.3|  356|Drosophila melanogaster CG4396-PA
           protein.
          Length = 356

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D +T K +GFGFV   +YD
Sbjct: 289 LWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYD 325



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   F++FG I++  ++ D  +G  +G GF+ FD  +  +R   + N
Sbjct: 146 LEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELN 192



 Score = 29.5 bits (63), Expect = 5.3
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT 329
           +G +  V V++D +T + KGFGF+T
Sbjct: 296 FGAVQSVKVIRDLQTSKCKGFGFVT 320


>AE014297-3189|AAF56024.1|  356|Drosophila melanogaster CG6937-PA
           protein.
          Length = 356

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/44 (38%), Positives = 27/44 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           ++LR+YF  FG ++ V +     TG  +G+ FVEF +Y  V +V
Sbjct: 65  QQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEF-EYPEVAKV 107


>AE014134-2184|AAN10813.1|  361|Drosophila melanogaster CG31762-PD,
           isoform D protein.
          Length = 361

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L   F  FGN++S  V  DK+T   + FGFV FD+ D
Sbjct: 293 LASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPD 329


>AE014134-2183|AAN10812.1|  604|Drosophila melanogaster CG31762-PA,
           isoform A protein.
          Length = 604

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L   F  FGN++S  V  DK+T   + FGFV FD+ D
Sbjct: 536 LASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPD 572



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEI 431
           +G +  + V++D  T  SKG  F+T+   H   +AQ+   + K    +  P +  P +  
Sbjct: 174 YGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSE 233

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            R E     +KLFV  L + + E D+
Sbjct: 234 NRNE-----RKLFVGMLNKKLNENDV 254


>AE014134-2182|AAN10811.1|  616|Drosophila melanogaster CG31762-PC,
           isoform C protein.
          Length = 616

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L   F  FGN++S  V  DK+T   + FGFV FD+ D
Sbjct: 548 LASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPD 584



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEI 431
           +G +  + V++D  T  SKG  F+T+   H   +AQ+   + K    +  P +  P +  
Sbjct: 174 YGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSE 233

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            R E     +KLFV  L + + E D+
Sbjct: 234 NRNE-----RKLFVGMLNKKLNENDV 254


>AE014134-2181|AAN10810.1|  810|Drosophila melanogaster CG31762-PB,
           isoform B protein.
          Length = 810

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L   F  FGN++S  V  DK+T   + FGFV FD+ D
Sbjct: 742 LASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPD 778



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEI 431
           +G +  + V++D  T  SKG  F+T+   H   +AQ+   + K    +  P +  P +  
Sbjct: 380 YGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSE 439

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            R E     +KLFV  L + + E D+
Sbjct: 440 NRNE-----RKLFVGMLNKKLNENDV 460


>AY089405-1|AAL90143.1|  251|Drosophila melanogaster AT22957p
           protein.
          Length = 251

 Score = 38.3 bits (85), Expect = 0.011
 Identities = 14/36 (38%), Positives = 26/36 (72%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +++RE F+T+GNIV V+++  K   + RG  F++F+
Sbjct: 141 KKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFE 176


>AE014297-2054|AAF55205.1|  251|Drosophila melanogaster CG5213-PA
           protein.
          Length = 251

 Score = 38.3 bits (85), Expect = 0.011
 Identities = 14/36 (38%), Positives = 26/36 (72%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +++RE F+T+GNIV V+++  K   + RG  F++F+
Sbjct: 141 KKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFE 176


>S51720-1|AAB24628.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 37.9 bits (84), Expect = 0.015
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           +  L  YF  FG+I+   V+ + E+G+ RGFGFV
Sbjct: 11  QENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFV 44



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFI 326
           + R    +G+I+D VVMK+ ++ RS+GFGF+
Sbjct: 14  LSRYFCRFGDIIDCVVMKNNESGRSRGFGFV 44


>AY060413-1|AAL25452.1|  307|Drosophila melanogaster LD36772p
           protein.
          Length = 307

 Score = 37.9 bits (84), Expect = 0.015
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           FS FGNI++ +V  D E G  RG+GFV FD
Sbjct: 133 FSVFGNILNCNVAKD-EDGNSRGYGFVHFD 161



 Score = 33.5 bits (73), Expect = 0.32
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           + LRE F  +G I S  ++ D+E G+ R FGFV +++
Sbjct: 217 QHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYEN 252


>AE013599-3890|AAF47219.1|  307|Drosophila melanogaster CG4612-PA
           protein.
          Length = 307

 Score = 37.9 bits (84), Expect = 0.015
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           FS FGNI++ +V  D E G  RG+GFV FD
Sbjct: 133 FSVFGNILNCNVAKD-EDGNSRGYGFVHFD 161



 Score = 33.5 bits (73), Expect = 0.32
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           + LRE F  +G I S  ++ D+E G+ R FGFV +++
Sbjct: 217 QHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYEN 252


>AY060398-1|AAL25437.1|  422|Drosophila melanogaster LD31834p
           protein.
          Length = 422

 Score = 37.1 bits (82), Expect = 0.026
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L + F  FGN++S  V  D+ T + + FGFV FD+
Sbjct: 353 LMQMFLPFGNVISSKVFIDRATNQSKCFGFVSFDN 387


>AE014296-2305|AAF49798.2|  422|Drosophila melanogaster CG12478-PA,
           isoform A protein.
          Length = 422

 Score = 37.1 bits (82), Expect = 0.026
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L + F  FGN++S  V  D+ T + + FGFV FD+
Sbjct: 353 LMQMFLPFGNVISSKVFIDRATNQSKCFGFVSFDN 387


>AE014296-2304|AAF49799.2|  363|Drosophila melanogaster CG12478-PB,
           isoform B protein.
          Length = 363

 Score = 37.1 bits (82), Expect = 0.026
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L + F  FGN++S  V  D+ T + + FGFV FD+
Sbjct: 294 LMQMFLPFGNVISSKVFIDRATNQSKCFGFVSFDN 328


>AE014134-3163|AAF53845.1|  154|Drosophila melanogaster CG10466-PA
           protein.
          Length = 154

 Score = 36.7 bits (81), Expect = 0.035
 Identities = 12/31 (38%), Positives = 24/31 (77%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G +V+++++ D +TGK +GF F+ ++D
Sbjct: 54  FSQYGEVVNINLIRDSKTGKSKGFCFLCYED 84



 Score = 33.5 bits (73), Expect = 0.32
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 368
           +GE+V++ +++D KT +SKGF F+ Y        A +N
Sbjct: 57  YGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDN 94


>S51715-1|AAB24627.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 36.3 bits (80), Expect = 0.046
 Identities = 13/24 (54%), Positives = 20/24 (83%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFI 326
           +G+I + +VMKDP T+RS+GF F+
Sbjct: 21  YGDISEAMVMKDPTTRRSRGFAFV 44



 Score = 33.9 bits (74), Expect = 0.25
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           LR+YF  +G+I    V+ D  T + RGF FV
Sbjct: 14  LRDYFGRYGDISEAMVMKDPTTRRSRGFAFV 44


>M21152-1|AAA28506.1|  483|Drosophila melanogaster elav protein.
          Length = 483

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV +V D  T + +G+GFV   +YD
Sbjct: 418 LWQLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYD 454



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQN 365
           +G +  V ++KDP T + KG+GF++   Y +A M   A N
Sbjct: 425 FGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALN 464


>BT003283-1|AAO25040.1|  178|Drosophila melanogaster HL05737p
           protein.
          Length = 178

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +3

Query: 288 DPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           D +  + KGF FIT+    +V +       KI G+ V+ KRA P+ E
Sbjct: 4   DKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE 50


>BT001384-1|AAN71139.1|  178|Drosophila melanogaster GH03391p
           protein.
          Length = 178

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +3

Query: 288 DPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           D +  + KGF FIT+    +V +       KI G+ V+ KRA P+ E
Sbjct: 4   DKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE 50


>AY122066-1|AAM52578.1|  690|Drosophila melanogaster AT09438p
           protein.
          Length = 690

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = +3

Query: 210 RL*NHRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKID 386
           RL   +  I ++   +GEIV+VV   D + K +KG+ F+ Y QA   +EA +    H++D
Sbjct: 71  RLEKLKLVINKLFSNYGEIVNVVYPVDEEGK-TKGYAFMEYKQARQAEEAVKKLNNHRLD 129


>AY060253-1|AAL25292.1|  238|Drosophila melanogaster GH07919p
           protein.
          Length = 238

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV V+ D ++ K +GFGFV   +Y+
Sbjct: 171 LWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYE 207



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 5/52 (9%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKET-----GKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS +G I++  ++ D  T     G  +G GF+ FD     DR   + N
Sbjct: 6   LESLFSPYGKIITSRILCDNITDEHAAGLSKGVGFIRFDQRFEADRAIKELN 57


>AY051822-1|AAK93246.1|  483|Drosophila melanogaster LD33076p
           protein.
          Length = 483

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV +V D  T + +G+GFV   +YD
Sbjct: 418 LWQLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYD 454



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQN 365
           +G +  V ++KDP T + KG+GF++   Y +A M   A N
Sbjct: 425 FGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALN 464


>AL022139-2|CAB37430.1|  483|Drosophila melanogaster
           EG:65F1.2,FBgn0000570;elav protein.
          Length = 483

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV +V D  T + +G+GFV   +YD
Sbjct: 418 LWQLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYD 454



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQN 365
           +G +  V ++KDP T + KG+GF++   Y +A M   A N
Sbjct: 425 FGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALN 464


>AL022139-1|CAA18091.1|  479|Drosophila melanogaster
           EG:65F1.2,FBgn0000570;elav protein.
          Length = 479

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV +V D  T + +G+GFV   +YD
Sbjct: 414 LWQLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYD 450



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQN 365
           +G +  V ++KDP T + KG+GF++   Y +A M   A N
Sbjct: 421 FGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALN 460


>AE014298-54|AAX52472.1|  479|Drosophila melanogaster CG4262-PB,
           isoform B protein.
          Length = 479

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV +V D  T + +G+GFV   +YD
Sbjct: 414 LWQLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYD 450



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQN 365
           +G +  V ++KDP T + KG+GF++   Y +A M   A N
Sbjct: 421 FGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALN 460


>AE014298-53|AAF45517.2|  483|Drosophila melanogaster CG4262-PA,
           isoform A protein.
          Length = 483

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + SV +V D  T + +G+GFV   +YD
Sbjct: 418 LWQLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYD 454



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQN 365
           +G +  V ++KDP T + KG+GF++   Y +A M   A N
Sbjct: 425 FGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALN 464


>AE014297-1707|AAS65146.1|  178|Drosophila melanogaster CG16901-PD,
           isoform D protein.
          Length = 178

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +3

Query: 288 DPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428
           D +  + KGF FIT+    +V +       KI G+ V+ KRA P+ E
Sbjct: 4   DKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE 50


>AE014134-2187|AAO41184.1|  737|Drosophila melanogaster CG31761-PD,
           isoform D protein.
          Length = 737

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/35 (42%), Positives = 21/35 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L   F  FGN++S  V  DK+T   + FGFV +D+
Sbjct: 668 LASTFLPFGNVLSAKVFIDKQTNLSKCFGFVSYDN 702


>AE014134-2186|ABI31310.1|  893|Drosophila melanogaster CG31761-PE,
           isoform E protein.
          Length = 893

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 15/35 (42%), Positives = 21/35 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L   F  FGN++S  V  DK+T   + FGFV +D+
Sbjct: 824 LASTFLPFGNVLSAKVFIDKQTNLSKCFGFVSYDN 858


>AE013599-2499|AAG22261.1|  690|Drosophila melanogaster CG4878-PB,
           isoform B protein.
          Length = 690

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = +3

Query: 210 RL*NHRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKID 386
           RL   +  I ++   +GEIV+VV   D + K +KG+ F+ Y QA   +EA +    H++D
Sbjct: 71  RLEKLKLVINKLFSNYGEIVNVVYPVDEEGK-TKGYAFMEYKQARQAEEAVKKLNNHRLD 129


>AE013599-2498|AAF57842.1|  690|Drosophila melanogaster CG4878-PA,
           isoform A protein.
          Length = 690

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = +3

Query: 210 RL*NHRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKID 386
           RL   +  I ++   +GEIV+VV   D + K +KG+ F+ Y QA   +EA +    H++D
Sbjct: 71  RLEKLKLVINKLFSNYGEIVNVVYPVDEEGK-TKGYAFMEYKQARQAEEAVKKLNNHRLD 129


>M31162-1|AAA28859.1|  448|Drosophila melanogaster protein (
           D.melanogaster U1 70Ksmall nuclear ribonucleoprotein
           gene, complete cds. ).
          Length = 448

 Score = 35.5 bits (78), Expect = 0.080
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +LR  F  +G I  + ++ D+E+GK +G+ F+E++
Sbjct: 117 KLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYE 151


>AY089622-1|AAL90360.1|  448|Drosophila melanogaster RE35772p
           protein.
          Length = 448

 Score = 35.5 bits (78), Expect = 0.080
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +LR  F  +G I  + ++ D+E+GK +G+ F+E++
Sbjct: 117 KLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYE 151


>AY071420-1|AAL49042.1|  302|Drosophila melanogaster RE50009p
           protein.
          Length = 302

 Score = 35.5 bits (78), Expect = 0.080
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L   F+ F +     VV DK TGK +GFGFV F
Sbjct: 214 LTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSF 246



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATV 458
           V++D +T +SKGFGF+++ +      A      ++DGR V  +    R+   R  +   V
Sbjct: 229 VVRDKRTGKSKGFGFVSFREPADFIRAMK----EMDGRYVGSRPIKLRKSTWRQRSLDVV 284

Query: 459 KK 464
           KK
Sbjct: 285 KK 286


>AY061501-1|AAL29049.1|  448|Drosophila melanogaster LD46049p
           protein.
          Length = 448

 Score = 35.5 bits (78), Expect = 0.080
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +LR  F  +G I  + ++ D+E+GK +G+ F+E++
Sbjct: 117 KLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYE 151


>AE014297-279|AAF52006.1|  302|Drosophila melanogaster CG2931-PA
           protein.
          Length = 302

 Score = 35.5 bits (78), Expect = 0.080
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L   F+ F +     VV DK TGK +GFGFV F
Sbjct: 214 LTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSF 246



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATV 458
           V++D +T +SKGFGF+++ +      A      ++DGR V  +    R+   R  +   V
Sbjct: 229 VVRDKRTGKSKGFGFVSFREPADFIRAMK----EMDGRYVGSRPIKLRKSTWRQRSLDVV 284

Query: 459 KK 464
           KK
Sbjct: 285 KK 286


>AE014134-1210|AAF52471.1|  448|Drosophila melanogaster CG8749-PA
           protein.
          Length = 448

 Score = 35.5 bits (78), Expect = 0.080
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +LR  F  +G I  + ++ D+E+GK +G+ F+E++
Sbjct: 117 KLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYE 151


>BT010058-1|AAQ22527.1|  865|Drosophila melanogaster LD15974p
           protein.
          Length = 865

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH--KIDGRIVEPKRAVPREE 428
           +G I+DV ++ + +   SKGFGF+T++ ++  + A+  R H   ++GR +E   A  R +
Sbjct: 400 FGTILDVEIIFNERG--SKGFGFVTFANSNDAERAR-ERLHGTVVEGRKIEVNNATARVQ 456

Query: 429 IKRPEASATV 458
            K+  A   V
Sbjct: 457 TKKVTAVPNV 466


>AY118678-1|AAM50538.1|  582|Drosophila melanogaster AT08247p
           protein.
          Length = 582

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH--KIDGRIVEPKRAVPREE 428
           +G I+DV ++ + +   SKGFGF+T++ ++  + A+  R H   ++GR +E   A  R +
Sbjct: 220 FGTILDVEIIFNERG--SKGFGFVTFANSNDAERAR-ERLHGTVVEGRKIEVNNATARVQ 276

Query: 429 IKRPEASATV 458
            K+  A   V
Sbjct: 277 TKKVTAVPNV 286


>AE014296-1825|AAF50154.2|  849|Drosophila melanogaster CG32062-PB,
           isoform B protein.
          Length = 849

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH--KIDGRIVEPKRAVPREE 428
           +G I+DV ++ + +   SKGFGF+T++ ++  + A+  R H   ++GR +E   A  R +
Sbjct: 458 FGTILDVEIIFNERG--SKGFGFVTFANSNDAERAR-ERLHGTVVEGRKIEVNNATARVQ 514

Query: 429 IKRPEASATV 458
            K+  A   V
Sbjct: 515 TKKVTAVPNV 524


>AE014296-1824|AAF50153.2|  881|Drosophila melanogaster CG32062-PD,
           isoform D protein.
          Length = 881

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH--KIDGRIVEPKRAVPREE 428
           +G I+DV ++ + +   SKGFGF+T++ ++  + A+  R H   ++GR +E   A  R +
Sbjct: 458 FGTILDVEIIFNERG--SKGFGFVTFANSNDAERAR-ERLHGTVVEGRKIEVNNATARVQ 514

Query: 429 IKRPEASATV 458
            K+  A   V
Sbjct: 515 TKKVTAVPNV 524


>L13038-1|AAA02941.1|  465|Drosophila melanogaster
           polyadenylate-binding protein protein.
          Length = 465

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE F+ FG I +  +V D  T K +G+ FV F
Sbjct: 111 LREAFAPFGEISNCRIVRDPHTMKSKGYAFVSF 143



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 10/26 (38%), Positives = 20/26 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY 332
           +GEI +  +++DP T +SKG+ F+++
Sbjct: 118 FGEISNCRIVRDPHTMKSKGYAFVSF 143


>L13037-1|AAA28828.1|  465|Drosophila melanogaster
           polyadenylate-binding protein protein.
          Length = 465

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE F+ FG I +  +V D  T K +G+ FV F
Sbjct: 111 LREAFAPFGEISNCRIVRDPHTMKSKGYAFVSF 143



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 10/26 (38%), Positives = 20/26 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY 332
           +GEI +  +++DP T +SKG+ F+++
Sbjct: 118 FGEISNCRIVRDPHTMKSKGYAFVSF 143


>AY118564-1|AAM49933.1|  578|Drosophila melanogaster LD40028p
           protein.
          Length = 578

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +G I+S   + DK T K +G+GFV+F+
Sbjct: 254 YGTIISTKAILDKTTNKCKGYGFVDFE 280



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 23/87 (26%), Positives = 40/87 (45%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I+    + D  T + KG+GF+ + Q    + A       + G+ V+ + A      K
Sbjct: 254 YGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKG----LQGKGVQAQMA------K 303

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
           + E   T   L++A L    +E DLE+
Sbjct: 304 QQEQDPT--NLYIANLPPHFKETDLEA 328


>AY094948-1|AAM11301.1|  379|Drosophila melanogaster RH63980p
           protein.
          Length = 379

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +G I+S   + DK T K +G+GFV+F+
Sbjct: 44  YGTIISTKAILDKTTNKCKGYGFVDFE 70



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 3/90 (3%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA-VPREEI 431
           +G I+    + D  T + KG+GF+ + Q    + A       + G+ V+ + A V    +
Sbjct: 44  YGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKG----LQGKGVQAQMAKVGIWVL 99

Query: 432 KRP--EASATVKKLFVAGLKQDIEEEDLES 515
            RP  +       L++A L    +E DLE+
Sbjct: 100 HRPAIQQEQDPTNLYIANLPPHFKETDLEA 129


>AY070612-1|AAL48083.1|  470|Drosophila melanogaster RE71384p
           protein.
          Length = 470

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE F+ FG I +  +V D  T K +G+ FV F
Sbjct: 111 LREAFAPFGEISNCRIVRDPHTMKSKGYAFVSF 143



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 10/26 (38%), Positives = 20/26 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY 332
           +GEI +  +++DP T +SKG+ F+++
Sbjct: 118 FGEISNCRIVRDPHTMKSKGYAFVSF 143


>AE014297-3445|AAN13978.1|  470|Drosophila melanogaster CG5422-PD,
           isoform D protein.
          Length = 470

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE F+ FG I +  +V D  T K +G+ FV F
Sbjct: 111 LREAFAPFGEISNCRIVRDPHTMKSKGYAFVSF 143



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 10/26 (38%), Positives = 20/26 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY 332
           +GEI +  +++DP T +SKG+ F+++
Sbjct: 118 FGEISNCRIVRDPHTMKSKGYAFVSF 143


>AE014297-3444|AAN13977.1|  464|Drosophila melanogaster CG5422-PF,
           isoform F protein.
          Length = 464

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE F+ FG I +  +V D  T K +G+ FV F
Sbjct: 111 LREAFAPFGEISNCRIVRDPHTMKSKGYAFVSF 143



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 10/26 (38%), Positives = 20/26 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY 332
           +GEI +  +++DP T +SKG+ F+++
Sbjct: 118 FGEISNCRIVRDPHTMKSKGYAFVSF 143


>AE014297-3443|AAF56224.1|  464|Drosophila melanogaster CG5422-PC,
           isoform C protein.
          Length = 464

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE F+ FG I +  +V D  T K +G+ FV F
Sbjct: 111 LREAFAPFGEISNCRIVRDPHTMKSKGYAFVSF 143



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 10/26 (38%), Positives = 20/26 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY 332
           +GEI +  +++DP T +SKG+ F+++
Sbjct: 118 FGEISNCRIVRDPHTMKSKGYAFVSF 143


>AE014297-3442|AAF56225.1|  464|Drosophila melanogaster CG5422-PB,
           isoform B protein.
          Length = 464

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           LRE F+ FG I +  +V D  T K +G+ FV F
Sbjct: 111 LREAFAPFGEISNCRIVRDPHTMKSKGYAFVSF 143



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 10/26 (38%), Positives = 20/26 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY 332
           +GEI +  +++DP T +SKG+ F+++
Sbjct: 118 FGEISNCRIVRDPHTMKSKGYAFVSF 143


>AE014296-940|AAF50792.3|  368|Drosophila melanogaster CG32423-PC,
           isoform C protein.
          Length = 368

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +G I+S   + DK T K +G+GFV+F+
Sbjct: 44  YGTIISTKAILDKTTNKCKGYGFVDFE 70



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 23/87 (26%), Positives = 40/87 (45%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I+    + D  T + KG+GF+ + Q    + A       + G+ V+ + A      K
Sbjct: 44  YGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKG----LQGKGVQAQMA------K 93

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
           + E   T   L++A L    +E DLE+
Sbjct: 94  QQEQDPT--NLYIANLPPHFKETDLEA 118


>AE014296-937|AAF50788.5|  578|Drosophila melanogaster CG32423-PA,
           isoform A protein.
          Length = 578

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +2

Query: 527 FGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +G I+S   + DK T K +G+GFV+F+
Sbjct: 254 YGTIISTKAILDKTTNKCKGYGFVDFE 280



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 23/87 (26%), Positives = 40/87 (45%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I+    + D  T + KG+GF+ + Q    + A       + G+ V+ + A      K
Sbjct: 254 YGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKG----LQGKGVQAQMA------K 303

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
           + E   T   L++A L    +E DLE+
Sbjct: 304 QQEQDPT--NLYIANLPPHFKETDLEA 328


>X97197-1|CAA65831.1|  366|Drosophila melanogaster spliceosomal
           protein protein.
          Length = 366

 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSV-SVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L + FS FG I+    ++ D ETGK + F F+ F  ++  D      N Q
Sbjct: 135 LYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDAMNGQ 184



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +3

Query: 252 AWGEIVDVV-VMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           A+G I+    +M+DP+T +SK F FI ++     D A +
Sbjct: 141 AFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMD 179


>BT023489-1|AAY84889.1|  347|Drosophila melanogaster RE50839p
           protein.
          Length = 347

 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSV-SVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L + FS FG I+    ++ D ETGK + F F+ F  ++  D      N Q
Sbjct: 116 LYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDAMNGQ 165



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           L E F   G +V+V +  D+ T   +G+GFVEF   +  D
Sbjct: 29  LWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDAD 68



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +3

Query: 252 AWGEIVDVV-VMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           A+G I+    +M+DP+T +SK F FI ++     D A +
Sbjct: 122 AFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMD 160


>AY113652-1|AAM29657.1|  918|Drosophila melanogaster SD14970p
           protein.
          Length = 918

 Score = 34.3 bits (75), Expect = 0.19
 Identities = 23/95 (24%), Positives = 49/95 (51%), Gaps = 6/95 (6%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVE--P 404
           ++++   +G +V+V +  D  T++ KGFG +TY       +A N        GR++   P
Sbjct: 380 LRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNTLDGTDFHGRLLHLLP 439

Query: 405 KRAV---PREEIKRPEASATVKKLFVAGLKQDIEE 500
            + +   P+E++   +AS + K+     LK++ ++
Sbjct: 440 SKDIEKNPKEDLDENDASLSFKEKKALKLKKNAQK 474



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGK--KRGFGFVEF 604
           R +R+ F  FG + S+ +     TG+   RGFGFV++
Sbjct: 799 REVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDY 835


>AE014298-857|AAF46136.1|  347|Drosophila melanogaster CG3780-PA
           protein.
          Length = 347

 Score = 34.3 bits (75), Expect = 0.19
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 506 LREYFSTFGNIVSV-SVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L + FS FG I+    ++ D ETGK + F F+ F  ++  D      N Q
Sbjct: 116 LYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDAMNGQ 165



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           L E F   G +V+V +  D+ T   +G+GFVEF   +  D
Sbjct: 29  LWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDAD 68



 Score = 29.9 bits (64), Expect = 4.0
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +3

Query: 252 AWGEIVDVV-VMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           A+G I+    +M+DP+T +SK F FI ++     D A +
Sbjct: 122 AFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMD 160


>AE014296-1695|AAF50237.1|  918|Drosophila melanogaster CG3335-PA
           protein.
          Length = 918

 Score = 34.3 bits (75), Expect = 0.19
 Identities = 23/95 (24%), Positives = 49/95 (51%), Gaps = 6/95 (6%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVE--P 404
           ++++   +G +V+V +  D  T++ KGFG +TY       +A N        GR++   P
Sbjct: 380 LRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNTLDGTDFHGRLLHLLP 439

Query: 405 KRAV---PREEIKRPEASATVKKLFVAGLKQDIEE 500
            + +   P+E++   +AS + K+     LK++ ++
Sbjct: 440 SKDIEKNPKEDLDENDASLSFKEKKALKLKKNAQK 474



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGK--KRGFGFVEF 604
           R +R+ F  FG + S+ +     TG+   RGFGFV++
Sbjct: 799 REVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDY 835


>S51738-1|AAB24630.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 33.9 bits (74), Expect = 0.25
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           +R  F +FG + S  ++ DK TG+  G+GFV
Sbjct: 14  IRSLFVSFGEVESCKLIRDKVTGQSLGYGFV 44


>AY061421-1|AAL28969.1|  300|Drosophila melanogaster LD35248p
           protein.
          Length = 300

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           R L   F  FG+I  + +  D E+ + RGF F+E++
Sbjct: 20  RLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYE 55



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVP 419
           +G+I D+ +  D +++R +GF FI Y Q+     A  N    ++ GR +    A P
Sbjct: 29  FGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAIDNMNDSELCGRTIRVNLAKP 84


>AF182826-1|AAF01031.1|  300|Drosophila melanogaster cyclophilin-33
           protein.
          Length = 300

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           R L   F  FG+I  + +  D E+ + RGF F+E++
Sbjct: 20  RLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYE 55



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVP 419
           +G+I D+ +  D +++R +GF FI Y Q+     A  N    ++ GR +    A P
Sbjct: 29  FGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAIDNMNDSELCGRTIRVNLAKP 84


>AF132148-1|AAD34736.1|  653|Drosophila melanogaster unknown
           protein.
          Length = 653

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS+FG +    V+ D++TG    + FVEF+D
Sbjct: 260 FSSFGVLKGCEVIRDRKTGDSLQYAFVEFED 290


>AE014297-3634|AAF56342.1|  653|Drosophila melanogaster CG5808-PA
           protein.
          Length = 653

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS+FG +    V+ D++TG    + FVEF+D
Sbjct: 260 FSSFGVLKGCEVIRDRKTGDSLQYAFVEFED 290


>AE013599-2502|AAF57839.1|  300|Drosophila melanogaster CG4886-PA
           protein.
          Length = 300

 Score = 33.1 bits (72), Expect = 0.43
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           R L   F  FG+I  + +  D E+ + RGF F+E++
Sbjct: 20  RLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYE 55



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVP 419
           +G+I D+ +  D +++R +GF FI Y Q+     A  N    ++ GR +    A P
Sbjct: 29  FGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAIDNMNDSELCGRTIRVNLAKP 84


>X79340-1|CAA55898.2|  213|Drosophila melanogaster musashi protein.
          Length = 213

 Score = 32.7 bits (71), Expect = 0.57
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           PS SG    +P    KLF+GGL ++T+   LKE++
Sbjct: 162 PSLSGGSGSDPA-PGKLFVGGLSWQTSSDKLKEYF 195


>AY069584-1|AAL39729.1|  195|Drosophila melanogaster LD32469p
           protein.
          Length = 195

 Score = 32.3 bits (70), Expect = 0.75
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFIT-YSQAHMVDEAQNNRPHKIDGR 392
           ++R+    GE+ D+ + +D  T+ S+GF F+  Y +    D  +      +DGR
Sbjct: 39  LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDGR 92


>AF232775-1|AAF43415.1|  195|Drosophila melanogaster SR family
           splicing factor SC35 protein.
          Length = 195

 Score = 32.3 bits (70), Expect = 0.75
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFIT-YSQAHMVDEAQNNRPHKIDGR 392
           ++R+    GE+ D+ + +D  T+ S+GF F+  Y +    D  +      +DGR
Sbjct: 39  LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDGR 92


>AE014134-2203|AAF53192.1|  195|Drosophila melanogaster CG5442-PB,
           isoform B protein.
          Length = 195

 Score = 32.3 bits (70), Expect = 0.75
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFIT-YSQAHMVDEAQNNRPHKIDGR 392
           ++R+    GE+ D+ + +D  T+ S+GF F+  Y +    D  +      +DGR
Sbjct: 39  LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDGR 92


>BT003317-1|AAO25077.1|  545|Drosophila melanogaster GH01086p
           protein.
          Length = 545

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +R  F+ FG I S+++  D  T K +GF FVE++
Sbjct: 54  IRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYE 87



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           IK +  A+G I+   + +       KG+GFI Y+    +DEA  +     + G+++   R
Sbjct: 151 IKSVFEAFGPILYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGR 210

Query: 411 AV-PREEIKRPEASATV 458
           ++ P   +  P  ++T+
Sbjct: 211 SITPPNALACPTTNSTM 227


>BT001582-1|AAN71337.1|  977|Drosophila melanogaster RE24907p
           protein.
          Length = 977

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L+  FS FG ++   VVT+  T   R +G+V         R C++  H+
Sbjct: 377 LKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASR-CIENLHR 424


>AY061541-1|AAL29089.1|  392|Drosophila melanogaster LP03039p
           protein.
          Length = 392

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L+  FS FG ++   VVT+  T   R +G+V         R C++  H+
Sbjct: 66  LKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASR-CIENLHR 113


>AY061006-1|AAL28554.1|  545|Drosophila melanogaster HL02140p
           protein.
          Length = 545

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +R  F+ FG I S+++  D  T K +GF FVE++
Sbjct: 54  IRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYE 87



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           IK +  A+G I+   + +       KG+GFI Y+    +DEA  +     + G+++   R
Sbjct: 151 IKSVFEAFGPILYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGR 210

Query: 411 AV-PREEIKRPEASATV 458
           ++ P   +  P  ++T+
Sbjct: 211 SITPPNALACPTTNSTM 227


>AF479079-1|AAL86452.1|  637|Drosophila melanogaster half pint
           protein.
          Length = 637

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +R  F+ FG I S+++  D  T K +GF FVE++
Sbjct: 146 IRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYE 179



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           IK +  A+G I+   + +       KG+GFI Y+    +DEA  +     + G+++   R
Sbjct: 243 IKSVFEAFGPILYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGR 302

Query: 411 AV-PREEIKRPEASATV 458
           ++ P   +  P  ++T+
Sbjct: 303 SITPPNALACPTTNSTM 319


>AF190745-1|AAF04132.1|  637|Drosophila melanogaster poly-U binding
           splicing factor protein.
          Length = 637

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +R  F+ FG I S+++  D  T K +GF FVE++
Sbjct: 146 IRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYE 179



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           IK +  A+G I+   + +       KG+GFI Y+    +DEA  +     + G+++   R
Sbjct: 243 IKSVFEAFGPILYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGR 302

Query: 411 AV-PREEIKRPEASATV 458
           ++ P   +  P  ++T+
Sbjct: 303 SITPPNALACPTTNSTM 319


>AE014297-3637|ABC66187.1|  392|Drosophila melanogaster CG6995-PC,
           isoform C protein.
          Length = 392

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L+  FS FG ++   VVT+  T   R +G+V         R C++  H+
Sbjct: 66  LKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASR-CIENLHR 113


>AE014297-3636|AAF56343.3|  666|Drosophila melanogaster CG6995-PA,
           isoform A protein.
          Length = 666

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L+  FS FG ++   VVT+  T   R +G+V         R C++  H+
Sbjct: 66  LKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASR-CIENLHR 113


>AE014297-3635|AAN14018.2|  928|Drosophila melanogaster CG6995-PB,
           isoform B protein.
          Length = 928

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           L+  FS FG ++   VVT+  T   R +G+V         R C++  H+
Sbjct: 328 LKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASR-CIENLHR 375


>AE014296-262|AAG22222.2|  545|Drosophila melanogaster CG12085-PD,
           isoform D protein.
          Length = 545

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +R  F+ FG I S+++  D  T K +GF FVE++
Sbjct: 54  IRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYE 87



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           IK +  A+G I+   + +       KG+GFI Y+    +DEA  +     + G+++   R
Sbjct: 151 IKSVFEAFGPILYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGR 210

Query: 411 AV-PREEIKRPEASATV 458
           ++ P   +  P  ++T+
Sbjct: 211 SITPPNALACPTTNSTM 227


>AE014296-261|AAF47502.1|  545|Drosophila melanogaster CG12085-PC,
           isoform C protein.
          Length = 545

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +R  F+ FG I S+++  D  T K +GF FVE++
Sbjct: 54  IRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYE 87



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           IK +  A+G I+   + +       KG+GFI Y+    +DEA  +     + G+++   R
Sbjct: 151 IKSVFEAFGPILYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGR 210

Query: 411 AV-PREEIKRPEASATV 458
           ++ P   +  P  ++T+
Sbjct: 211 SITPPNALACPTTNSTM 227


>AE014296-260|AAG22221.1|  545|Drosophila melanogaster CG12085-PB,
           isoform B protein.
          Length = 545

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +R  F+ FG I S+++  D  T K +GF FVE++
Sbjct: 54  IRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYE 87



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           IK +  A+G I+   + +       KG+GFI Y+    +DEA  +     + G+++   R
Sbjct: 151 IKSVFEAFGPILYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGR 210

Query: 411 AV-PREEIKRPEASATV 458
           ++ P   +  P  ++T+
Sbjct: 211 SITPPNALACPTTNSTM 227


>AE014296-259|AAF47501.1|  637|Drosophila melanogaster CG12085-PA,
           isoform A protein.
          Length = 637

 Score = 31.9 bits (69), Expect = 0.99
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           +R  F+ FG I S+++  D  T K +GF FVE++
Sbjct: 146 IRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYE 179



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410
           IK +  A+G I+   + +       KG+GFI Y+    +DEA  +     + G+++   R
Sbjct: 243 IKSVFEAFGPILYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGR 302

Query: 411 AV-PREEIKRPEASATV 458
           ++ P   +  P  ++T+
Sbjct: 303 SITPPNALACPTTNSTM 319


>S51695-1|AAB24625.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 31.5 bits (68), Expect = 1.3
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFI 326
           +G + D VV++DP +  S+GFGF+
Sbjct: 21  FGIVADAVVLRDPVSNHSRGFGFM 44



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           LR +FS FG +    V+ D  +   RGFGF+
Sbjct: 14  LRGFFSQFGIVADAVVLRDPVSNHSRGFGFM 44


>BT003653-1|AAO39657.1|  626|Drosophila melanogaster AT01548p
           protein.
          Length = 626

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 22/82 (26%), Positives = 40/82 (48%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I D+ +M DP T  ++G+ F+T++      EA  N   ++D   ++P + + +  I  
Sbjct: 149 GIIWDLRLMMDPMTGTNRGYAFVTFTNR----EAAVNAVRQLDNHEIKPGKCL-KINISV 203

Query: 438 PEASATVKKLFVAGLKQDIEEE 503
           P     V  +  +  K +I EE
Sbjct: 204 PNLRLFVGNIPKSKGKDEILEE 225


>AY075220-1|AAL68087.1|  449|Drosophila melanogaster AT16577p
           protein.
          Length = 449

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +K +L ++GE+  + ++ D  T  +KGF F  Y    + D A
Sbjct: 258 VKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHA 299



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           +++E   +FG +  +++V D  T   +GF F E+ D    D
Sbjct: 257 QVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTD 297


>AE014297-2864|AAN13834.1|  529|Drosophila melanogaster CG17838-PF,
           isoform F protein.
          Length = 529

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 22/82 (26%), Positives = 40/82 (48%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I D+ +M DP T  ++G+ F+T++      EA  N   ++D   ++P + + +  I  
Sbjct: 188 GIIWDLRLMMDPMTGTNRGYAFVTFTNR----EAAVNAVRQLDNHEIKPGKCL-KINISV 242

Query: 438 PEASATVKKLFVAGLKQDIEEE 503
           P     V  +  +  K +I EE
Sbjct: 243 PNLRLFVGNIPKSKGKDEILEE 264


>AE014297-2863|AAN13833.1|  529|Drosophila melanogaster CG17838-PC,
           isoform C protein.
          Length = 529

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 22/82 (26%), Positives = 40/82 (48%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I D+ +M DP T  ++G+ F+T++      EA  N   ++D   ++P + + +  I  
Sbjct: 188 GIIWDLRLMMDPMTGTNRGYAFVTFTNR----EAAVNAVRQLDNHEIKPGKCL-KINISV 242

Query: 438 PEASATVKKLFVAGLKQDIEEE 503
           P     V  +  +  K +I EE
Sbjct: 243 PNLRLFVGNIPKSKGKDEILEE 264


>AE014297-2862|AAF55805.2|  707|Drosophila melanogaster CG17838-PD,
           isoform D protein.
          Length = 707

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 22/82 (26%), Positives = 40/82 (48%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I D+ +M DP T  ++G+ F+T++      EA  N   ++D   ++P + + +  I  
Sbjct: 230 GIIWDLRLMMDPMTGTNRGYAFVTFTNR----EAAVNAVRQLDNHEIKPGKCL-KINISV 284

Query: 438 PEASATVKKLFVAGLKQDIEEE 503
           P     V  +  +  K +I EE
Sbjct: 285 PNLRLFVGNIPKSKGKDEILEE 306


>AE014297-2861|AAN13831.1|  571|Drosophila melanogaster CG17838-PE,
           isoform E protein.
          Length = 571

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 22/82 (26%), Positives = 40/82 (48%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I D+ +M DP T  ++G+ F+T++      EA  N   ++D   ++P + + +  I  
Sbjct: 230 GIIWDLRLMMDPMTGTNRGYAFVTFTNR----EAAVNAVRQLDNHEIKPGKCL-KINISV 284

Query: 438 PEASATVKKLFVAGLKQDIEEE 503
           P     V  +  +  K +I EE
Sbjct: 285 PNLRLFVGNIPKSKGKDEILEE 306


>AE014297-2858|AAN13832.2|  563|Drosophila melanogaster CG17838-PA,
           isoform A protein.
          Length = 563

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 22/82 (26%), Positives = 40/82 (48%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I D+ +M DP T  ++G+ F+T++      EA  N   ++D   ++P + + +  I  
Sbjct: 222 GIIWDLRLMMDPMTGTNRGYAFVTFTNR----EAAVNAVRQLDNHEIKPGKCL-KINISV 276

Query: 438 PEASATVKKLFVAGLKQDIEEE 503
           P     V  +  +  K +I EE
Sbjct: 277 PNLRLFVGNIPKSKGKDEILEE 298


>AE013599-3557|AAF46969.1|  449|Drosophila melanogaster CG3162-PA
           protein.
          Length = 449

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           +K +L ++GE+  + ++ D  T  +KGF F  Y    + D A
Sbjct: 258 VKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHA 299



 Score = 30.7 bits (66), Expect = 2.3
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           +++E   +FG +  +++V D  T   +GF F E+ D    D
Sbjct: 257 QVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTD 297


>S51727-1|AAB24633.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           L + F  FG + SV  + D ++ K +GFGFV
Sbjct: 14  LWQLFGPFGAVQSVKEIRDLQSNKCKGFGFV 44


>BT003308-1|AAO25068.1|  459|Drosophila melanogaster GH07080p
           protein.
          Length = 459

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           FS F  + +V ++ D+ET + +G+G+VEF+    + +  L  N +IK  N
Sbjct: 83  FSDF-EVKNVRLIKDRETDEFKGYGYVEFETLAQL-KSALNCNGRIKLDN 130


>BT001280-1|AAN71036.1|  370|Drosophila melanogaster AT07793p
           protein.
          Length = 370

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           FS F  + +V ++ D+ET + +G+G+VEF+    + +  L  N +IK  N
Sbjct: 4   FSDF-EVKNVRLIKDRETDEFKGYGYVEFETLAQL-KSALNCNGRIKLDN 51


>AE014297-4654|AAF57078.1|  459|Drosophila melanogaster CG1340-PA
           protein.
          Length = 459

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           FS F  + +V ++ D+ET + +G+G+VEF+    + +  L  N +IK  N
Sbjct: 83  FSDF-EVKNVRLIKDRETDEFKGYGYVEFETLAQL-KSALNCNGRIKLDN 130


>BT024190-1|ABC86252.1|  358|Drosophila melanogaster RH12113p
           protein.
          Length = 358

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 15/38 (39%), Positives = 26/38 (68%)
 Frame = +2

Query: 545 VSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           V +V D+ET + +GF +VEF+  D ++R  L+ + +IK
Sbjct: 57  VRLVKDRETDQFKGFCYVEFETLDNLER-ALECDGRIK 93


>AE014298-2413|AAN09409.1|  324|Drosophila melanogaster CG4429-PB,
           isoform B protein.
          Length = 324

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 15/38 (39%), Positives = 26/38 (68%)
 Frame = +2

Query: 545 VSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           V +V D+ET + +GF +VEF+  D ++R  L+ + +IK
Sbjct: 56  VRLVKDRETDQFKGFCYVEFETLDNLER-ALECDGRIK 92


>AE014298-2412|AAF48616.1|  325|Drosophila melanogaster CG4429-PA,
           isoform A protein.
          Length = 325

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 15/38 (39%), Positives = 26/38 (68%)
 Frame = +2

Query: 545 VSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           V +V D+ET + +GF +VEF+  D ++R  L+ + +IK
Sbjct: 57  VRLVKDRETDQFKGFCYVEFETLDNLER-ALECDGRIK 93


>AE014298-2411|AAS65388.1|  358|Drosophila melanogaster CG4429-PC,
           isoform C protein.
          Length = 358

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 15/38 (39%), Positives = 26/38 (68%)
 Frame = +2

Query: 545 VSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           V +V D+ET + +GF +VEF+  D ++R  L+ + +IK
Sbjct: 57  VRLVKDRETDQFKGFCYVEFETLDNLER-ALECDGRIK 93


>BT015266-1|AAT94495.1|  459|Drosophila melanogaster LD33831p
           protein.
          Length = 459

 Score = 29.5 bits (63), Expect = 5.3
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVT-DKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L E+F    N++S+ +   D E G+ RGFG+VE ++ + +  V    +  IK
Sbjct: 96  LYEFFEGI-NLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIK 146


>AY071474-1|AAL49096.1|  390|Drosophila melanogaster RE54950p
           protein.
          Length = 390

 Score = 29.5 bits (63), Expect = 5.3
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVT-DKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L E+F    N++S+ +   D E G+ RGFG+VE ++ + +  V    +  IK
Sbjct: 96  LYEFFEGI-NLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIK 146


>X62599-1|CAA44483.1|  376|Drosophila melanogaster 52-kD bracketing
           protein protein.
          Length = 376

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>X58720-1|CAA41556.1|  350|Drosophila melanogaster SRp55 protein.
          Length = 350

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>L34934-1|AAA73522.1|  224|Drosophila melanogaster RNA binding
           protein protein.
          Length = 224

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKR 661
           L  +F   G I  V+++ +K  G  +GF ++EF   + V+   L  N  + R
Sbjct: 112 LEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVE-TALAMNETLFR 162


>BT011006-1|AAR27877.1|  690|Drosophila melanogaster AT27578p
           protein.
          Length = 690

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRG------FGFVEFDDYDPVDRVCL 637
           LRE FS FGN++ + +++        G      +GF+ +DD + V + CL
Sbjct: 509 LREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAVQK-CL 557


>BT003286-1|AAO25044.1|  350|Drosophila melanogaster GM10155p
           protein.
          Length = 350

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>BT003171-1|AAO24926.1|  443|Drosophila melanogaster SD07604p
           protein.
          Length = 443

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I    +M+D KT  S G+GF+ Y      +    +   K++G  V  KR   +    R
Sbjct: 117 GPINTCKIMRDFKTGYSFGYGFVDYK----TESDSEDAIQKLNGFYVRNKRL--KVSYAR 170

Query: 438 PEA-SATVKKLFVAGLKQDIEEEDLE 512
           P   S     L+V  L ++I ++ L+
Sbjct: 171 PGGQSIKDTNLYVINLSRNINDDMLD 196


>BT001495-1|AAN71250.1|  350|Drosophila melanogaster LD30815p
           protein.
          Length = 350

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>BT001482-1|AAN71237.1|  187|Drosophila melanogaster LD22171p
           protein.
          Length = 187

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 33  KNGYGFVEFEDYRDADDAVYELN 55


>BT001477-1|AAN71232.1|  443|Drosophila melanogaster LD21345p
           protein.
          Length = 443

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I    +M+D KT  S G+GF+ Y      +    +   K++G  V  KR   +    R
Sbjct: 117 GPINTCKIMRDFKTGYSFGYGFVDYK----TESDSEDAIQKLNGFYVRNKRL--KVSYAR 170

Query: 438 PEA-SATVKKLFVAGLKQDIEEEDLE 512
           P   S     L+V  L ++I ++ L+
Sbjct: 171 PGGQSIKDTNLYVINLSRNINDDMLD 196


>AY113327-1|AAM29332.1|  350|Drosophila melanogaster AT29232p
           protein.
          Length = 350

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>AY075519-1|AAL68327.1|  224|Drosophila melanogaster RE69521p
           protein.
          Length = 224

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKR 661
           L  +F   G I  V+++ +K  G  +GF ++EF   + V+   L  N  + R
Sbjct: 112 LEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVE-TALAMNETLFR 162


>AY070631-1|AAL48102.1|  224|Drosophila melanogaster RE74211p
           protein.
          Length = 224

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKR 661
           L  +F   G I  V+++ +K  G  +GF ++EF   + V+   L  N  + R
Sbjct: 112 LEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVE-TALAMNETLFR 162


>AY058617-1|AAL13846.1|  690|Drosophila melanogaster LD31194p
           protein.
          Length = 690

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRG------FGFVEFDDYDPVDRVCL 637
           LRE FS FGN++ + +++        G      +GF+ +DD + V + CL
Sbjct: 509 LREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAVQK-CL 557


>AL023893-1|CAA19655.1|  485|Drosophila melanogaster EG:132E8.1
           protein.
          Length = 485

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I    +M+D KT  S G+GF+ Y      +    +   K++G  V  KR   +    R
Sbjct: 117 GPINTCKIMRDFKTGYSFGYGFVDYK----TESDSEDAIQKLNGFYVRNKRL--KVSYAR 170

Query: 438 PEA-SATVKKLFVAGLKQDIEEEDLE 512
           P   S     L+V  L ++I ++ L+
Sbjct: 171 PGGQSIKDTNLYVINLSRNINDDMLD 196


>AF231031-1|AAF68949.1|  690|Drosophila melanogaster rasputin
           protein.
          Length = 690

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRG------FGFVEFDDYDPVDRVCL 637
           LRE FS FGN++ + +++        G      +GF+ +DD + V + CL
Sbjct: 509 LREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAVQK-CL 557


>AF116341-1|AAF00976.1|  224|Drosophila melanogaster poly(A)-binding
           protein II protein.
          Length = 224

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKR 661
           L  +F   G I  V+++ +K  G  +GF ++EF   + V+   L  N  + R
Sbjct: 112 LEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVE-TALAMNETLFR 162


>AE014298-190|AAS65244.1|  443|Drosophila melanogaster CG3056-PB,
           isoform B protein.
          Length = 443

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I    +M+D KT  S G+GF+ Y      +    +   K++G  V  KR   +    R
Sbjct: 117 GPINTCKIMRDFKTGYSFGYGFVDYK----TESDSEDAIQKLNGFYVRNKRL--KVSYAR 170

Query: 438 PEA-SATVKKLFVAGLKQDIEEEDLE 512
           P   S     L+V  L ++I ++ L+
Sbjct: 171 PGGQSIKDTNLYVINLSRNINDDMLD 196


>AE014298-189|AAF45613.1|  485|Drosophila melanogaster CG3056-PA,
           isoform A protein.
          Length = 485

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           G I    +M+D KT  S G+GF+ Y      +    +   K++G  V  KR   +    R
Sbjct: 117 GPINTCKIMRDFKTGYSFGYGFVDYK----TESDSEDAIQKLNGFYVRNKRL--KVSYAR 170

Query: 438 PEA-SATVKKLFVAGLKQDIEEEDLE 512
           P   S     L+V  L ++I ++ L+
Sbjct: 171 PGGQSIKDTNLYVINLSRNINDDMLD 196


>AE014297-1722|AAN13578.1|  147|Drosophila melanogaster CG10851-PF,
           isoform F protein.
          Length = 147

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>AE014297-1721|AAN13577.1|  135|Drosophila melanogaster CG10851-PD,
           isoform D protein.
          Length = 135

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>AE014297-1720|AAF54968.1|  329|Drosophila melanogaster CG10851-PB,
           isoform B protein.
          Length = 329

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>AE014297-1719|AAN13576.1|  346|Drosophila melanogaster CG10851-PE,
           isoform E protein.
          Length = 346

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>AE014297-1718|AAN13575.1|  350|Drosophila melanogaster CG10851-PC,
           isoform C protein.
          Length = 350

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>AE014297-1717|AAF54969.2|  350|Drosophila melanogaster CG10851-PA,
           isoform A protein.
          Length = 350

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 578 KRGFGFVEFDDYDPVDRVCLQQN 646
           K G+GFVEF+DY   D    + N
Sbjct: 36  KNGYGFVEFEDYRDADDAVYELN 58


>AE014297-1713|AAN13573.1|  690|Drosophila melanogaster CG9412-PE,
           isoform E protein.
          Length = 690

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRG------FGFVEFDDYDPVDRVCL 637
           LRE FS FGN++ + +++        G      +GF+ +DD + V + CL
Sbjct: 509 LREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAVQK-CL 557


>AE014297-1712|AAN13572.1|  690|Drosophila melanogaster CG9412-PD,
           isoform D protein.
          Length = 690

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRG------FGFVEFDDYDPVDRVCL 637
           LRE FS FGN++ + +++        G      +GF+ +DD + V + CL
Sbjct: 509 LREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAVQK-CL 557


>AE014297-1711|AAN13571.1|  690|Drosophila melanogaster CG9412-PC,
           isoform C protein.
          Length = 690

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRG------FGFVEFDDYDPVDRVCL 637
           LRE FS FGN++ + +++        G      +GF+ +DD + V + CL
Sbjct: 509 LREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAVQK-CL 557


>AE014297-1710|AAG22151.2|  690|Drosophila melanogaster CG9412-PB,
           isoform B protein.
          Length = 690

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRG------FGFVEFDDYDPVDRVCL 637
           LRE FS FGN++ + +++        G      +GF+ +DD + V + CL
Sbjct: 509 LREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAVQK-CL 557


>AE014297-1709|AAF54965.3|  690|Drosophila melanogaster CG9412-PA,
           isoform A protein.
          Length = 690

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRG------FGFVEFDDYDPVDRVCL 637
           LRE FS FGN++ + +++        G      +GF+ +DD + V + CL
Sbjct: 509 LREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAVQK-CL 557


>AE014297-952|AAF54387.1|  632|Drosophila melanogaster CG9373-PA
           protein.
          Length = 632

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = +2

Query: 530 GNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           G+I  V +  D E+GK RG G VEF D + V +   + N
Sbjct: 82  GSIEYVQLFFD-ESGKARGCGIVEFKDPENVQKALEKMN 119


>AE013599-599|AAM68852.1|  224|Drosophila melanogaster CG2163-PB,
           isoform B protein.
          Length = 224

 Score = 28.7 bits (61), Expect = 9.2
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKR 661
           L  +F   G I  V+++ +K  G  +GF ++EF   + V+   L  N  + R
Sbjct: 112 LEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVE-TALAMNETLFR 162


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,806,894
Number of Sequences: 53049
Number of extensions: 597523
Number of successful extensions: 2408
Number of sequences better than 10.0: 251
Number of HSP's better than 10.0 without gapping: 1791
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2389
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3520086471
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).