SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY069569-1|AAL39714.1|  476|Drosophila melanogaster LD29847p pro...    68   7e-12
AE014134-1100|AAF52389.2|  476|Drosophila melanogaster CG9539-PA...    68   7e-12
AB062670-1|BAB78518.1|  476|Drosophila melanogaster DSec61alpha ...    68   7e-12
AE014134-2436|AAN10860.1|  424|Drosophila melanogaster CG31765-P...    31   1.0  
AY875639-1|AAX59985.1| 1854|Drosophila melanogaster Dp205 protein.     27   9.4  
AY119261-1|AAM51121.1|  940|Drosophila melanogaster SD22791p pro...    27   9.4  
AY060685-1|AAL28233.1|  388|Drosophila melanogaster GH12561p pro...    27   9.4  
AY059435-1|AAL13341.1|  609|Drosophila melanogaster GH02003p pro...    27   9.4  
AL031583-4|CAA20898.1| 1045|Drosophila melanogaster EG:34F3.4 pr...    27   9.4  
AE014298-108|AAF45550.2|  940|Drosophila melanogaster CG16989-PA...    27   9.4  
AE014297-2674|ABI31177.1| 1854|Drosophila melanogaster CG34157-P...    27   9.4  
AE014296-2294|AAF49806.1|  516|Drosophila melanogaster CG32130-P...    27   9.4  
AE014296-2293|AAF49808.1|  516|Drosophila melanogaster CG32130-P...    27   9.4  
AE014296-2292|AAF49807.1|  542|Drosophila melanogaster CG32130-P...    27   9.4  
AE014296-2291|AAF49809.2|  609|Drosophila melanogaster CG32130-P...    27   9.4  
AE014134-532|AAN10405.1| 1028|Drosophila melanogaster CG3558-PB,...    27   9.4  

>AY069569-1|AAL39714.1|  476|Drosophila melanogaster LD29847p
           protein.
          Length = 476

 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 32/38 (84%), Positives = 33/38 (86%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ+EMGGM TLLF
Sbjct: 439 GAIGSGTGILLAVTIIYQYFEIFVKEQSEMGGMGTLLF 476



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSV+ADFLGAIGSG
Sbjct: 416 YIPTAAAFGGLCIGALSVMADFLGAIGSG 444


>AE014134-1100|AAF52389.2|  476|Drosophila melanogaster CG9539-PA
           protein.
          Length = 476

 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 32/38 (84%), Positives = 33/38 (86%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ+EMGGM TLLF
Sbjct: 439 GAIGSGTGILLAVTIIYQYFEIFVKEQSEMGGMGTLLF 476



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSV+ADFLGAIGSG
Sbjct: 416 YIPTAAAFGGLCIGALSVMADFLGAIGSG 444


>AB062670-1|BAB78518.1|  476|Drosophila melanogaster DSec61alpha
           protein.
          Length = 476

 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 32/38 (84%), Positives = 33/38 (86%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ+EMGGM TLLF
Sbjct: 439 GAIGSGTGILLAVTIIYQYFEIFVKEQSEMGGMGTLLF 476



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSV+ADFLGAIGSG
Sbjct: 416 YIPTAAAFGGLCIGALSVMADFLGAIGSG 444


>AE014134-2436|AAN10860.1|  424|Drosophila melanogaster CG31765-PA
           protein.
          Length = 424

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 5/57 (8%)
 Frame = -3

Query: 421 HHPRTRRHA-HNTTPVGALPSTQQILNLKSNFFD----KVQRCIHIQHYQI*KRTPN 266
           HHPR+ +H  H+TT    LP+  QI+     F +      QR  H+ H  I  +  N
Sbjct: 352 HHPRSHQHVQHSTTASQFLPARPQIMPANDQFSNGSVHPHQRSHHVTHLIIPPQNSN 408


>AY875639-1|AAX59985.1| 1854|Drosophila melanogaster Dp205 protein.
          Length = 1854

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 27/125 (21%), Positives = 53/125 (42%)
 Frame = -3

Query: 379 VGALPSTQQILNLKSNFFDKVQRCIHIQHYQI*KRTPNDVDSSRNDNKNGAERSGPTAAI 200
           VG  P+    ++  +    + QR + +   Q  ++  N V ++ +   NG ++    AA+
Sbjct: 181 VGGSPAQSSFVDYNAQ---QQQRLLQLSRQQ--QQLRNAVTAAAS-TANGGDKETLYAAL 234

Query: 199 ITRLRRAVCSCRPSPLVP*QRSRSTGK*W*RRAVSQCPEPMAPRKSASTDRAPMHSPPNA 20
             + R++  + +P+P VP  R  +               P+ PR+S ST R P+      
Sbjct: 235 FQQYRQSPTNGQPAPPVPLHRKPAAA-------------PVVPRRSQSTPRPPLQQQQQQ 281

Query: 19  AAVGM 5
              G+
Sbjct: 282 QQAGI 286


>AY119261-1|AAM51121.1|  940|Drosophila melanogaster SD22791p
           protein.
          Length = 940

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
 Frame = -1

Query: 270 LMMSIRAETTIKT-ELNAAVRLPLSLRDLE-EQCAHAAHLRLFLDKDLEVLVNDGDGEQY 97
           L+M +   T+  T E+ +++ L  S R+L+ E  + A   +   D D E+ + +GD +Q 
Sbjct: 391 LVMEMLVGTSKLTPEIASSIGLAPSQRNLQMEHASTAETYQELCDSDAEMELEEGDEQQQ 450

Query: 96  PS 91
           PS
Sbjct: 451 PS 452


>AY060685-1|AAL28233.1|  388|Drosophila melanogaster GH12561p
           protein.
          Length = 388

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -3

Query: 109 RRAVSQCPEPMAPRKSASTDRAPMHSPPNAAA 14
           RR++S+    M  RKSAST  AP +    AA+
Sbjct: 209 RRSISKSITSMFSRKSASTSTAPPNGSSGAAS 240


>AY059435-1|AAL13341.1|  609|Drosophila melanogaster GH02003p
           protein.
          Length = 609

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 3/61 (4%)
 Frame = -3

Query: 184 RAVCSCRPSPLVP*QRSRSTGK*W*RRAVSQCPEPMAPRKSAST---DRAPMHSPPNAAA 14
           RA     P+P      +  TG      A  Q  EP+ P+   +T   +  P+ +PPNAAA
Sbjct: 522 RAASGAAPAPSAT-APAVDTGAVAASEAAGQNAEPVTPQPQDATKMQEPIPLPAPPNAAA 580

Query: 13  V 11
           V
Sbjct: 581 V 581


>AL031583-4|CAA20898.1| 1045|Drosophila melanogaster EG:34F3.4
           protein.
          Length = 1045

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
 Frame = -1

Query: 270 LMMSIRAETTIKT-ELNAAVRLPLSLRDLE-EQCAHAAHLRLFLDKDLEVLVNDGDGEQY 97
           L+M +   T+  T E+ +++ L  S R+L+ E  + A   +   D D E+ + +GD +Q 
Sbjct: 496 LVMEMLVGTSKLTPEIASSIGLAPSQRNLQMEHASTAETYQELCDSDAEMELEEGDEQQQ 555

Query: 96  PS 91
           PS
Sbjct: 556 PS 557


>AE014298-108|AAF45550.2|  940|Drosophila melanogaster CG16989-PA
           protein.
          Length = 940

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
 Frame = -1

Query: 270 LMMSIRAETTIKT-ELNAAVRLPLSLRDLE-EQCAHAAHLRLFLDKDLEVLVNDGDGEQY 97
           L+M +   T+  T E+ +++ L  S R+L+ E  + A   +   D D E+ + +GD +Q 
Sbjct: 391 LVMEMLVGTSKLTPEIASSIGLAPSQRNLQMEHASTAETYQELCDSDAEMELEEGDEQQQ 450

Query: 96  PS 91
           PS
Sbjct: 451 PS 452


>AE014297-2674|ABI31177.1| 1854|Drosophila melanogaster CG34157-PD,
           isoform D protein.
          Length = 1854

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 27/125 (21%), Positives = 53/125 (42%)
 Frame = -3

Query: 379 VGALPSTQQILNLKSNFFDKVQRCIHIQHYQI*KRTPNDVDSSRNDNKNGAERSGPTAAI 200
           VG  P+    ++  +    + QR + +   Q  ++  N V ++ +   NG ++    AA+
Sbjct: 181 VGGSPAQSSFVDYNAQ---QQQRLLQLSRQQ--QQLRNAVTAAAS-TANGGDKETLYAAL 234

Query: 199 ITRLRRAVCSCRPSPLVP*QRSRSTGK*W*RRAVSQCPEPMAPRKSASTDRAPMHSPPNA 20
             + R++  + +P+P VP  R  +               P+ PR+S ST R P+      
Sbjct: 235 FQQYRQSPTNGQPAPPVPLHRKPAAA-------------PVVPRRSQSTPRPPLQQQQQQ 281

Query: 19  AAVGM 5
              G+
Sbjct: 282 QQAGI 286


>AE014296-2294|AAF49806.1|  516|Drosophila melanogaster CG32130-PD,
           isoform D protein.
          Length = 516

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 3/61 (4%)
 Frame = -3

Query: 184 RAVCSCRPSPLVP*QRSRSTGK*W*RRAVSQCPEPMAPRKSAST---DRAPMHSPPNAAA 14
           RA     P+P      +  TG      A  Q  EP+ P+   +T   +  P+ +PPNAAA
Sbjct: 429 RAASGAAPAPSAT-APAVDTGAVAASEAAGQNAEPVTPQPQDATKMQEPIPLPAPPNAAA 487

Query: 13  V 11
           V
Sbjct: 488 V 488


>AE014296-2293|AAF49808.1|  516|Drosophila melanogaster CG32130-PB,
           isoform B protein.
          Length = 516

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 3/61 (4%)
 Frame = -3

Query: 184 RAVCSCRPSPLVP*QRSRSTGK*W*RRAVSQCPEPMAPRKSAST---DRAPMHSPPNAAA 14
           RA     P+P      +  TG      A  Q  EP+ P+   +T   +  P+ +PPNAAA
Sbjct: 429 RAASGAAPAPSAT-APAVDTGAVAASEAAGQNAEPVTPQPQDATKMQEPIPLPAPPNAAA 487

Query: 13  V 11
           V
Sbjct: 488 V 488


>AE014296-2292|AAF49807.1|  542|Drosophila melanogaster CG32130-PC,
           isoform C protein.
          Length = 542

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 3/61 (4%)
 Frame = -3

Query: 184 RAVCSCRPSPLVP*QRSRSTGK*W*RRAVSQCPEPMAPRKSAST---DRAPMHSPPNAAA 14
           RA     P+P      +  TG      A  Q  EP+ P+   +T   +  P+ +PPNAAA
Sbjct: 455 RAASGAAPAPSAT-APAVDTGAVAASEAAGQNAEPVTPQPQDATKMQEPIPLPAPPNAAA 513

Query: 13  V 11
           V
Sbjct: 514 V 514


>AE014296-2291|AAF49809.2|  609|Drosophila melanogaster CG32130-PA,
           isoform A protein.
          Length = 609

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 3/61 (4%)
 Frame = -3

Query: 184 RAVCSCRPSPLVP*QRSRSTGK*W*RRAVSQCPEPMAPRKSAST---DRAPMHSPPNAAA 14
           RA     P+P      +  TG      A  Q  EP+ P+   +T   +  P+ +PPNAAA
Sbjct: 522 RAASGAAPAPSAT-APAVDTGAVAASEAAGQNAEPVTPQPQDATKMQEPIPLPAPPNAAA 580

Query: 13  V 11
           V
Sbjct: 581 V 581


>AE014134-532|AAN10405.1| 1028|Drosophila melanogaster CG3558-PB,
           isoform B protein.
          Length = 1028

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -3

Query: 109 RRAVSQCPEPMAPRKSASTDRAPMHSPPNAAA 14
           RR++S+    M  RKSAST  AP +    AA+
Sbjct: 849 RRSISKSITSMFSRKSASTSTAPPNGSSGAAS 880


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,914,786
Number of Sequences: 53049
Number of extensions: 465291
Number of successful extensions: 1660
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1565
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1660
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1559812275
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).