SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30007
         (796 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-801|AAF46087.1|  145|Drosophila melanogaster CG4052-PA ...    56   6e-08
BT016066-1|AAV36951.1|  138|Drosophila melanogaster LP12967p pro...    54   3e-07
AE014296-1422|AAF50443.2|  407|Drosophila melanogaster CG7072-PA...    54   3e-07
AY061158-1|AAL28706.1|  180|Drosophila melanogaster LD12613p pro...    53   4e-07
AE014296-371|AAF47580.1|  180|Drosophila melanogaster CG1919-PA ...    53   4e-07
AE014297-500|AAF54093.1|  199|Drosophila melanogaster CG2341-PA ...    53   5e-07
AE001572-16|AAD19806.1|  199|Drosophila melanogaster cuticle pro...    53   5e-07
AE014297-498|AAF54095.1|  151|Drosophila melanogaster CG1331-PA ...    52   7e-07
AE001572-18|AAD19808.1|  151|Drosophila melanogaster cuticle pro...    52   7e-07
AY070590-1|AAL48061.1|  247|Drosophila melanogaster RE69226p pro...    52   9e-07
AE014296-795|AAF47864.2|  247|Drosophila melanogaster CG1259-PB ...    52   9e-07
BT011017-1|AAR30177.1|  205|Drosophila melanogaster RH14104p pro...    51   2e-06
AE014297-503|AAF54090.1|  205|Drosophila melanogaster CG2360-PA ...    51   2e-06
AE014297-502|AAF54091.1|  221|Drosophila melanogaster CG1252-PA ...    51   2e-06
AE001572-14|AAD19804.1|  221|Drosophila melanogaster cuticle pro...    51   2e-06
AE001572-13|AAD19803.1|  205|Drosophila melanogaster cuticle pro...    51   2e-06
BT024400-1|ABC86462.1|  162|Drosophila melanogaster IP05056p pro...    50   4e-06
AE014296-1423|AAF50442.1|  162|Drosophila melanogaster CG7076-PA...    50   4e-06
BT011451-1|AAR99109.1|  340|Drosophila melanogaster RE37955p pro...    50   5e-06
AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA...    50   5e-06
AE014134-1758|AAN10718.1|  340|Drosophila melanogaster CG33302-P...    50   5e-06
AY070676-1|AAL48147.1|  221|Drosophila melanogaster RH13984p pro...    49   6e-06
AY070951-1|AAL48573.1|  208|Drosophila melanogaster RE04882p pro...    49   8e-06
AE014297-499|AAF54094.1|  208|Drosophila melanogaster CG1330-PA ...    49   8e-06
AE001572-17|AAD19807.1|  208|Drosophila melanogaster cuticle pro...    49   8e-06
BT010217-1|AAQ23535.1|  194|Drosophila melanogaster RH05746p pro...    48   1e-05
AE014296-370|AAF47579.2|  194|Drosophila melanogaster CG13935-PA...    48   1e-05
AM294620-1|CAL26618.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294619-1|CAL26617.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294618-1|CAL26616.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294617-1|CAL26615.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294616-1|CAL26614.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294615-1|CAL26613.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294614-1|CAL26612.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294613-1|CAL26611.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294612-1|CAL26610.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294611-1|CAL26609.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294610-1|CAL26608.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AM294609-1|CAL26607.1|  204|Drosophila melanogaster CG9283 protein.    48   1e-05
AE014296-3162|AAF49153.1|  204|Drosophila melanogaster CG9283-PA...    48   1e-05
AE014297-501|AAF54092.1|  217|Drosophila melanogaster CG1327-PA ...    47   3e-05
AE001572-15|AAD19805.1|  217|Drosophila melanogaster cuticle pro...    47   3e-05
AE014296-3163|AAF49152.1|  198|Drosophila melanogaster CG9290-PA...    46   6e-05
BT022677-1|AAY55093.1|  202|Drosophila melanogaster IP07124p pro...    45   1e-04
AE014296-794|AAF47863.1|  188|Drosophila melanogaster CG15008-PA...    45   1e-04
AE014134-1731|AAN10713.1|  146|Drosophila melanogaster CG31876-P...    45   1e-04
BT023126-1|AAY55542.1|  245|Drosophila melanogaster IP08764p pro...    44   2e-04
BT023042-1|AAY55458.1|  245|Drosophila melanogaster IP08564p pro...    44   2e-04
AY070633-1|AAL48104.1|  192|Drosophila melanogaster RH01578p pro...    44   2e-04
AE014297-2676|AAF55678.2|  245|Drosophila melanogaster CG6240-PA...    44   2e-04
AE014296-793|AAF47862.1|  147|Drosophila melanogaster CG15007-PA...    44   2e-04
AE014296-792|AAF47861.1|  192|Drosophila melanogaster CG15006-PA...    44   2e-04
BT022916-1|AAY55332.1|  136|Drosophila melanogaster IP04416p pro...    43   4e-04
AY121656-1|AAM51983.1|  206|Drosophila melanogaster RE04513p pro...    43   4e-04
AE014297-497|AAF54096.1|  191|Drosophila melanogaster CG2342-PA ...    43   4e-04
AE001572-19|AAD19809.1|  191|Drosophila melanogaster cuticle pro...    43   4e-04
M71249-1|AAA28501.1|  188|Drosophila melanogaster cuticle protei...    42   7e-04
AE014297-496|AAF54097.2|  188|Drosophila melanogaster CG2345-PA ...    42   7e-04
AE001572-20|AAD19810.1|  188|Drosophila melanogaster pupal-cutic...    42   7e-04
Y18453-1|CAA77177.1|  472|Drosophila melanogaster drosocrystalli...    42   0.001
AY119178-1|AAM51038.1|  477|Drosophila melanogaster RH66281p pro...    42   0.001
AE014134-2114|AAF53134.2|  477|Drosophila melanogaster CG16963-P...    42   0.001
BT024343-1|ABC86405.1|  266|Drosophila melanogaster IP09562p pro...    42   0.001
AE014296-1421|AAF50444.1|  266|Drosophila melanogaster CG13670-P...    42   0.001
AE014134-1730|AAN10712.1|  146|Drosophila melanogaster CG31878-P...    42   0.001
AE014134-1729|AAN10711.1|  106|Drosophila melanogaster CG31878-P...    42   0.001
BT022412-1|AAY54828.1|  424|Drosophila melanogaster IP11572p pro...    41   0.002
BT022352-1|AAY54768.1|  424|Drosophila melanogaster IP11272p pro...    41   0.002
BT022288-1|AAY54704.1|  424|Drosophila melanogaster IP11372p pro...    41   0.002
BT022236-1|AAY54652.1|  424|Drosophila melanogaster IP11472p pro...    41   0.002
AE014134-1650|AAF52783.2|  153|Drosophila melanogaster CG3818-PA...    41   0.002
AE014297-2840|AAF55794.1|  381|Drosophila melanogaster CG5494-PA...    40   0.004
AE014134-2498|AAF53397.1|  218|Drosophila melanogaster CG3474-PA...    40   0.004
BT022990-1|AAY55406.1|  155|Drosophila melanogaster IP08464p pro...    39   0.009
AE014296-3164|AAF49151.1|  401|Drosophila melanogaster CG9295-PB...    39   0.009
AY071231-1|AAL48853.1|  217|Drosophila melanogaster RE26879p pro...    38   0.016
AE013599-2993|AAF57484.2|  217|Drosophila melanogaster CG9036-PA...    38   0.016
AY071302-1|AAL48924.1|  302|Drosophila melanogaster RE33041p pro...    38   0.021
AE014134-486|AAF51198.2|  302|Drosophila melanogaster CG2973-PA ...    38   0.021
AY071527-1|AAL49149.1|  270|Drosophila melanogaster RE57183p pro...    36   0.048
AE014296-1500|AAF50383.2|  270|Drosophila melanogaster CG32029-P...    36   0.048
AY089582-1|AAL90320.1|  304|Drosophila melanogaster RE11615p pro...    33   0.34 
AE014297-4808|AAF57197.2|  304|Drosophila melanogaster CG2126-PA...    33   0.34 
BT011532-1|AAS15668.1|  131|Drosophila melanogaster RE06402p pro...    32   1.0  
AY071430-1|AAL49052.1|  141|Drosophila melanogaster RE51966p pro...    32   1.0  
AE014296-3153|AAF49158.2|  141|Drosophila melanogaster CG18294-P...    32   1.0  
AE014296-3152|AAF49159.2|  131|Drosophila melanogaster CG12519-P...    32   1.0  
AE014296-3149|AAF49160.1|  122|Drosophila melanogaster CG14096-P...    32   1.0  
AE014296-861|AAF47911.2|  456|Drosophila melanogaster CG11350-PB...    31   1.4  
AE014134-2140|AAF53151.1|   69|Drosophila melanogaster CG6770-PA...    31   1.8  
AY071659-1|AAL49281.1|  436|Drosophila melanogaster RE74364p pro...    31   2.4  
AL121806-10|CAB58085.1|  692|Drosophila melanogaster EG:BACR42I1...    31   2.4  
AE014298-161|AAF45593.2|  436|Drosophila melanogaster CG11381-PA...    31   2.4  
AE014296-3145|AAS64972.1|  255|Drosophila melanogaster CG33255-P...    30   3.2  
AE014296-2697|AAF49491.2|  155|Drosophila melanogaster CG13059-P...    30   3.2  
AE014296-3154|AAN11648.1|  154|Drosophila melanogaster CG32213-P...    30   4.2  
AE014296-3151|AAN11647.1|  154|Drosophila melanogaster CG32208-P...    30   4.2  
AE014296-3150|AAN11646.1|  141|Drosophila melanogaster CG32214-P...    30   4.2  
AE013599-3864|AAF47201.1|  830|Drosophila melanogaster CG3419-PA...    29   5.5  
AE013599-3461|AAF46899.2| 1218|Drosophila melanogaster CG3536-PA...    29   5.5  
AY071448-1|AAL49070.1|  815|Drosophila melanogaster RE53044p pro...    29   9.7  
AE013599-1762|AAF58339.2|  815|Drosophila melanogaster CG13338-P...    29   9.7  
AE013599-1477|AAF58517.1|  126|Drosophila melanogaster CG8510-PA...    29   9.7  

>AE014298-801|AAF46087.1|  145|Drosophila melanogaster CG4052-PA
           protein.
          Length = 145

 Score = 56.0 bits (129), Expect = 6e-08
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 8/74 (10%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKVIAPAHKVL-------VSAHHEEEY-AHPKYDFAYSVADG 467
           AA+A V  A  +++AAPVA   APA   +       V A  +EEY  HP+Y +AY V D 
Sbjct: 14  AASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYAYDVQDA 73

Query: 468 HSGDNKSQHESRDG 509
            SGD+KSQ E RDG
Sbjct: 74  ISGDSKSQVEERDG 87



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQR-YRQQHRPRFTTQLMLPTAPV 661
           D V GEY+LV++DG  R V+YTAD  +GF     ++   +   + + P APV
Sbjct: 88  DVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKTVVKTVAPVAPV 139


>BT016066-1|AAV36951.1|  138|Drosophila melanogaster LP12967p
           protein.
          Length = 138

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 35/102 (34%), Positives = 44/102 (43%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQ 491
           A A P+      HYA P     AP     V A H E  A+PKY F Y + D H+GD KSQ
Sbjct: 14  AQAVPIELG---HYA-PALVHHAPVLSHAVHAVHAEPVAYPKYSFNYGIKDPHTGDIKSQ 69

Query: 492 HESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
            E RDG +       ++       +         FNA+V  T
Sbjct: 70  AEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKT 111



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPR--FTTQLMLPTAPVLLGSSL 679
           D V G+Y+LVE DGSVR V+YTADDH+GF     +  P        +L  APVL  + L
Sbjct: 76  DVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPSKIIAHAPVLHAAPVLAHAPL 134


>AE014296-1422|AAF50443.2|  407|Drosophila melanogaster CG7072-PA
           protein.
          Length = 407

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 35/102 (34%), Positives = 44/102 (43%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQ 491
           A A P+      HYA P     AP     V A H E  A+PKY F Y + D H+GD KSQ
Sbjct: 53  AQAVPIELG---HYA-PALVHHAPVLSHAVHAVHAEPVAYPKYSFNYGIKDPHTGDIKSQ 108

Query: 492 HESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIVSNT 617
            E RDG +       ++       +         FNA+V  T
Sbjct: 109 AEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKT 150



 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 24/42 (57%), Positives = 29/42 (69%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTT 634
           D V G+Y+LVE DGSVR V+YTADDH+GF     +  PR  T
Sbjct: 115 DVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPRPNT 156


>AY061158-1|AAL28706.1|  180|Drosophila melanogaster LD12613p
           protein.
          Length = 180

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
 Frame = +3

Query: 408 HHEEE---YAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPL 578
           HH+E    +A+PKY + Y VAD H+GD KSQHE RDG +   S   ++       +    
Sbjct: 41  HHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTA 100

Query: 579 TTTTAFNAIVSNT 617
                FNA+V  T
Sbjct: 101 DDHNGFNAVVHKT 113



 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 22/29 (75%), Positives = 24/29 (82%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+LVE DGSVR VEYTADDH+GF
Sbjct: 78  DVVKGSYSLVEPDGSVRTVEYTADDHNGF 106


>AE014296-371|AAF47580.1|  180|Drosophila melanogaster CG1919-PA
           protein.
          Length = 180

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
 Frame = +3

Query: 408 HHEEE---YAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPL 578
           HH+E    +A+PKY + Y VAD H+GD KSQHE RDG +   S   ++       +    
Sbjct: 41  HHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTA 100

Query: 579 TTTTAFNAIVSNT 617
                FNA+V  T
Sbjct: 101 DDHNGFNAVVHKT 113



 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 22/29 (75%), Positives = 24/29 (82%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+LVE DGSVR VEYTADDH+GF
Sbjct: 78  DVVKGSYSLVEPDGSVRTVEYTADDHNGF 106


>AE014297-500|AAF54093.1|  199|Drosophila melanogaster CG2341-PA
           protein.
          Length = 199

 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 33/72 (45%), Positives = 40/72 (55%), Gaps = 6/72 (8%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKV-----IAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHS 473
           AA+A V     V++AAP         +A AH   V A   EEY  HP+Y +AY V D  S
Sbjct: 14  AASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQDSLS 73

Query: 474 GDNKSQHESRDG 509
           GD+KSQ E RDG
Sbjct: 74  GDSKSQVEERDG 85



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V+YTAD  +GF
Sbjct: 86  DVVRGEYSLIDADGYKRTVQYTADPINGF 114


>AE001572-16|AAD19806.1|  199|Drosophila melanogaster cuticle
           protein protein.
          Length = 199

 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 33/72 (45%), Positives = 40/72 (55%), Gaps = 6/72 (8%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKV-----IAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHS 473
           AA+A V     V++AAP         +A AH   V A   EEY  HP+Y +AY V D  S
Sbjct: 14  AASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQDSLS 73

Query: 474 GDNKSQHESRDG 509
           GD+KSQ E RDG
Sbjct: 74  GDSKSQVEERDG 85



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V+YTAD  +GF
Sbjct: 86  DVVRGEYSLIDADGYKRTVQYTADPINGF 114


>AE014297-498|AAF54095.1|  151|Drosophila melanogaster CG1331-PA
           protein.
          Length = 151

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 33/72 (45%), Positives = 39/72 (54%), Gaps = 6/72 (8%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKV-----IAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHS 473
           AA+A V     V++AAP         +A AH   V     EEY  HP+Y FAY V D  S
Sbjct: 14  AASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSLS 73

Query: 474 GDNKSQHESRDG 509
           GD+KSQ E RDG
Sbjct: 74  GDSKSQVEERDG 85



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/29 (55%), Positives = 23/29 (79%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHGEY+L+++DG  R V+YT+D  +GF
Sbjct: 86  DVVHGEYSLIDSDGYKRIVQYTSDPVNGF 114


>AE001572-18|AAD19808.1|  151|Drosophila melanogaster cuticle
           protein protein.
          Length = 151

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 33/72 (45%), Positives = 39/72 (54%), Gaps = 6/72 (8%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKV-----IAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHS 473
           AA+A V     V++AAP         +A AH   V     EEY  HP+Y FAY V D  S
Sbjct: 14  AASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSLS 73

Query: 474 GDNKSQHESRDG 509
           GD+KSQ E RDG
Sbjct: 74  GDSKSQVEERDG 85



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/29 (55%), Positives = 23/29 (79%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHGEY+L+++DG  R V+YT+D  +GF
Sbjct: 86  DVVHGEYSLIDSDGYKRIVQYTSDPVNGF 114


>AY070590-1|AAL48061.1|  247|Drosophila melanogaster RE69226p
           protein.
          Length = 247

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 13/119 (10%)
 Frame = +3

Query: 291 PHATNYIAAAAPV--HYASPVH--YAAPVAKVIAP---------AHKVLVSAHHEEEYAH 431
           P A  + A  APV    A+PV    AAPVA V AP         A  V      E   AH
Sbjct: 84  PFAAPFAAPVAPVAARLAAPVAAPLAAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAH 143

Query: 432 PKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIV 608
           P+Y FAY V D  +GD+K+Q E+RDG +   S   ++       +S    +   FNA+V
Sbjct: 144 PQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVV 202



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVL 664
           D V G Y+L+E DGS R V Y AD  +GF    Q+  P      + P APVL
Sbjct: 170 DVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVP----VAVAPVAPVL 217


>AE014296-795|AAF47864.2|  247|Drosophila melanogaster CG1259-PB
           protein.
          Length = 247

 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 13/119 (10%)
 Frame = +3

Query: 291 PHATNYIAAAAPV--HYASPVH--YAAPVAKVIAP---------AHKVLVSAHHEEEYAH 431
           P A  + A  APV    A+PV    AAPVA V AP         A  V      E   AH
Sbjct: 84  PFAAPFAAPVAPVAARLAAPVAAPLAAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAH 143

Query: 432 PKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNAIV 608
           P+Y FAY V D  +GD+K+Q E+RDG +   S   ++       +S    +   FNA+V
Sbjct: 144 PQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVV 202



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 23/52 (44%), Positives = 28/52 (53%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVL 664
           D V G Y+L+E DGS R V Y AD  +GF    Q+  P      + P APVL
Sbjct: 170 DVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVP----VAVAPVAPVL 217


>BT011017-1|AAR30177.1|  205|Drosophila melanogaster RH14104p
           protein.
          Length = 205

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +3

Query: 297 ATNYIAAAAP-VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHS 473
           +  Y   AAP V++A+P   A      +A A KV+V A  E +  HP+Y F+Y V D  +
Sbjct: 16  SAGYAPIAAPQVYHAAPA-VATYAHAPVAVAQKVVVKAAEEYD-PHPQYRFSYGVDDKLT 73

Query: 474 GDNKSQHESRDG 509
           GDNK Q E RDG
Sbjct: 74  GDNKGQVEERDG 85



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V+YTAD  +GF
Sbjct: 86  DVVRGEYSLIDADGYKRIVQYTADPINGF 114



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = +3

Query: 273 ILRHDQPHATNYIAAAAPVHYASPVHYAAP-VAKVIAP-AHKVLVSAHHEEEYAHPKYDF 446
           + ++  P   +Y A A     A   HYAAP V K +AP AH    +A+    YA P +  
Sbjct: 140 VAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAY--ATYAAPTHYA 197

Query: 447 AYSVA 461
           A +VA
Sbjct: 198 APAVA 202


>AE014297-503|AAF54090.1|  205|Drosophila melanogaster CG2360-PA
           protein.
          Length = 205

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +3

Query: 297 ATNYIAAAAP-VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHS 473
           +  Y   AAP V++A+P   A      +A A KV+V A  E +  HP+Y F+Y V D  +
Sbjct: 16  SAGYAPIAAPQVYHAAPA-VATYAHAPVAVAQKVVVKAAEEYD-PHPQYRFSYGVDDKLT 73

Query: 474 GDNKSQHESRDG 509
           GDNK Q E RDG
Sbjct: 74  GDNKGQVEERDG 85



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V+YTAD  +GF
Sbjct: 86  DVVRGEYSLIDADGYKRIVQYTADPINGF 114



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = +3

Query: 273 ILRHDQPHATNYIAAAAPVHYASPVHYAAP-VAKVIAP-AHKVLVSAHHEEEYAHPKYDF 446
           + ++  P   +Y A A     A   HYAAP V K +AP AH    +A+    YA P +  
Sbjct: 140 VAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAY--ATYAAPTHYA 197

Query: 447 AYSVA 461
           A +VA
Sbjct: 198 APAVA 202


>AE014297-502|AAF54091.1|  221|Drosophila melanogaster CG1252-PA
           protein.
          Length = 221

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +3

Query: 297 ATNYIAAAAP-VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHS 473
           +  Y   AAP V++A+P   A      +A A KV+V A  E +  HP+Y F+Y V D  +
Sbjct: 16  SAGYAPIAAPQVYHAAPA-VATYAHAPVAVAQKVVVKAAEEYD-PHPQYRFSYGVDDKLT 73

Query: 474 GDNKSQHESRDG 509
           GDNK Q E RDG
Sbjct: 74  GDNKGQVEERDG 85



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V+YTAD  +GF
Sbjct: 86  DVVRGEYSLIDADGYKRTVQYTADPINGF 114



 Score = 36.7 bits (81), Expect = 0.036
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 306 YIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHH 413
           Y   AAP HYA+P HYAAP A   + +    V+ HH
Sbjct: 187 YATYAAPTHYAAPAHYAAPAATYTSYSAPA-VAYHH 221



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 16/28 (57%), Positives = 18/28 (64%)
 Frame = +3

Query: 303 NYIAAAAPVHYASPVHYAAPVAKVIAPA 386
           +Y A AA   YA+P HYAAP A   APA
Sbjct: 180 HYAAPAAYATYAAPTHYAAP-AHYAAPA 206



 Score = 29.1 bits (62), Expect = 7.3
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = +3

Query: 273 ILRHDQPHATNYIAAAAPVHYASPVHYAAP-VAKVIAP-AHKVLVSAHHEEEYAHPKY 440
           + ++  P   +Y A A     A   HYAAP V K +AP AH    +A+    YA P +
Sbjct: 140 VAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAY--ATYAAPTH 195


>AE001572-14|AAD19804.1|  221|Drosophila melanogaster cuticle
           protein protein.
          Length = 221

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +3

Query: 297 ATNYIAAAAP-VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHS 473
           +  Y   AAP V++A+P   A      +A A KV+V A  E +  HP+Y F+Y V D  +
Sbjct: 16  SAGYAPIAAPQVYHAAPA-VATYAHAPVAVAQKVVVKAAEEYD-PHPQYRFSYGVDDKLT 73

Query: 474 GDNKSQHESRDG 509
           GDNK Q E RDG
Sbjct: 74  GDNKGQVEERDG 85



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V+YTAD  +GF
Sbjct: 86  DVVRGEYSLIDADGYKRTVQYTADPINGF 114



 Score = 36.7 bits (81), Expect = 0.036
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 306 YIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHH 413
           Y   AAP HYA+P HYAAP A   + +    V+ HH
Sbjct: 187 YATYAAPTHYAAPAHYAAPAATYTSYSAPA-VAYHH 221



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 16/28 (57%), Positives = 18/28 (64%)
 Frame = +3

Query: 303 NYIAAAAPVHYASPVHYAAPVAKVIAPA 386
           +Y A AA   YA+P HYAAP A   APA
Sbjct: 180 HYAAPAAYATYAAPTHYAAP-AHYAAPA 206



 Score = 29.1 bits (62), Expect = 7.3
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = +3

Query: 273 ILRHDQPHATNYIAAAAPVHYASPVHYAAP-VAKVIAP-AHKVLVSAHHEEEYAHPKY 440
           + ++  P   +Y A A     A   HYAAP V K +AP AH    +A+    YA P +
Sbjct: 140 VAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAY--ATYAAPTH 195


>AE001572-13|AAD19803.1|  205|Drosophila melanogaster cuticle
           protein protein.
          Length = 205

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +3

Query: 297 ATNYIAAAAP-VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHS 473
           +  Y   AAP V++A+P   A      +A A KV+V A  E +  HP+Y F+Y V D  +
Sbjct: 16  SAGYAPIAAPQVYHAAPA-VATYAHAPVAVAQKVVVKAAEEYD-PHPQYRFSYGVDDKLT 73

Query: 474 GDNKSQHESRDG 509
           GDNK Q E RDG
Sbjct: 74  GDNKGQVEERDG 85



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V+YTAD  +GF
Sbjct: 86  DVVRGEYSLIDADGYKRIVQYTADPINGF 114



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = +3

Query: 273 ILRHDQPHATNYIAAAAPVHYASPVHYAAP-VAKVIAP-AHKVLVSAHHEEEYAHPKYDF 446
           + ++  P   +Y A A     A   HYAAP V K +AP AH    +A+    YA P +  
Sbjct: 140 VAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAY--ATYAAPTHYA 197

Query: 447 AYSVA 461
           A +VA
Sbjct: 198 APAVA 202


>BT024400-1|ABC86462.1|  162|Drosophila melanogaster IP05056p
           protein.
          Length = 162

 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 26/69 (37%), Positives = 33/69 (47%)
 Frame = +3

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTT 590
           H + YA PKY F Y V D H+GD KSQHE+RDG         ++       +        
Sbjct: 80  HVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHN 139

Query: 591 AFNAIVSNT 617
            FNA+V  T
Sbjct: 140 GFNAVVHKT 148


>AE014296-1423|AAF50442.1|  162|Drosophila melanogaster CG7076-PA
           protein.
          Length = 162

 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 26/69 (37%), Positives = 33/69 (47%)
 Frame = +3

Query: 411 HEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTT 590
           H + YA PKY F Y V D H+GD KSQHE+RDG         ++       +        
Sbjct: 80  HVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHN 139

Query: 591 AFNAIVSNT 617
            FNA+V  T
Sbjct: 140 GFNAVVHKT 148


>BT011451-1|AAR99109.1|  340|Drosophila melanogaster RE37955p
           protein.
          Length = 340

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/58 (50%), Positives = 35/58 (60%)
 Frame = +3

Query: 336 ASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           A+PV  AAPV K +A A  VL     E     P+YDF+Y V D  +GD KSQ E+RDG
Sbjct: 105 AAPV-VAAPVVKTVAAAPAVLKQVELESS---PRYDFSYGVHDSITGDIKSQVETRDG 158



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQ 613
           V G Y++++ADG  R V YTADD +GF    Q+
Sbjct: 161 VVGSYSVLDADGFKRTVTYTADDINGFNAVVQR 193


>AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA
            protein.
          Length = 1242

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 22/40 (55%), Positives = 26/40 (65%)
 Frame = +3

Query: 390  KVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
            KV+   H E   AHP+Y F Y+V D H+GDNK Q E RDG
Sbjct: 1151 KVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDG 1190



 Score = 39.1 bits (87), Expect = 0.007
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +2

Query: 509  DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
            D V GEY+LVE DG+VR V+Y AD   GF
Sbjct: 1191 DVVKGEYSLVEPDGNVRTVKYYADWETGF 1219


>AE014134-1758|AAN10718.1|  340|Drosophila melanogaster CG33302-PA
           protein.
          Length = 340

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/58 (50%), Positives = 35/58 (60%)
 Frame = +3

Query: 336 ASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           A+PV  AAPV K +A A  VL     E     P+YDF+Y V D  +GD KSQ E+RDG
Sbjct: 105 AAPV-VAAPVVKTVAAAPAVLKQVELESS---PRYDFSYGVHDSITGDIKSQVETRDG 158



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQ 613
           V G Y++++ADG  R V YTADD +GF    Q+
Sbjct: 161 VVGSYSVLDADGFKRTVTYTADDINGFNAVVQR 193


>AY070676-1|AAL48147.1|  221|Drosophila melanogaster RH13984p
           protein.
          Length = 221

 Score = 49.2 bits (112), Expect = 6e-06
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +3

Query: 297 ATNYIAAAAP-VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHS 473
           +  Y   AAP V++A+P   A      +A A KV+V A  E +  HP+Y F+Y V D  +
Sbjct: 16  SAGYAPIAAPQVYHAAPA-VATYAHATVAVAQKVVVKAAEEYD-PHPQYRFSYGVDDKLT 73

Query: 474 GDNKSQHESRDG 509
           GDNK Q E R G
Sbjct: 74  GDNKGQVEERGG 85



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V+YTAD  +GF
Sbjct: 86  DVVRGEYSLIDADGYKRTVQYTADPINGF 114



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +3

Query: 306 YIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHH 413
           Y   AAP HYA+P HYAAP A   + +  V V+ HH
Sbjct: 187 YATYAAPTHYAAPAHYAAPAATYTSYSAPV-VAYHH 221



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 16/28 (57%), Positives = 18/28 (64%)
 Frame = +3

Query: 303 NYIAAAAPVHYASPVHYAAPVAKVIAPA 386
           +Y A AA   YA+P HYAAP A   APA
Sbjct: 180 HYAAPAAYATYAAPTHYAAP-AHYAAPA 206



 Score = 29.1 bits (62), Expect = 7.3
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = +3

Query: 273 ILRHDQPHATNYIAAAAPVHYASPVHYAAP-VAKVIAP-AHKVLVSAHHEEEYAHPKY 440
           + ++  P   +Y A A     A   HYAAP V K +AP AH    +A+    YA P +
Sbjct: 140 VAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAY--ATYAAPTH 195


>AY070951-1|AAL48573.1|  208|Drosophila melanogaster RE04882p
           protein.
          Length = 208

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 25/61 (40%), Positives = 33/61 (54%)
 Frame = +3

Query: 327 VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRD 506
           V + + +  AAPVA   AP   +  +   EE   HP+Y ++Y V D  SGDNK   E RD
Sbjct: 14  VAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERD 73

Query: 507 G 509
           G
Sbjct: 74  G 74



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V YTAD  +GF
Sbjct: 75  DVVRGEYSLIDADGFKRTVTYTADSINGF 103


>AE014297-499|AAF54094.1|  208|Drosophila melanogaster CG1330-PA
           protein.
          Length = 208

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 25/61 (40%), Positives = 33/61 (54%)
 Frame = +3

Query: 327 VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRD 506
           V + + +  AAPVA   AP   +  +   EE   HP+Y ++Y V D  SGDNK   E RD
Sbjct: 14  VAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERD 73

Query: 507 G 509
           G
Sbjct: 74  G 74



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V YTAD  +GF
Sbjct: 75  DVVRGEYSLIDADGFKRTVTYTADSINGF 103


>AE001572-17|AAD19807.1|  208|Drosophila melanogaster cuticle
           protein protein.
          Length = 208

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 25/61 (40%), Positives = 33/61 (54%)
 Frame = +3

Query: 327 VHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRD 506
           V + + +  AAPVA   AP   +  +   EE   HP+Y ++Y V D  SGDNK   E RD
Sbjct: 14  VAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERD 73

Query: 507 G 509
           G
Sbjct: 74  G 74



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V GEY+L++ADG  R V YTAD  +GF
Sbjct: 75  DVVRGEYSLIDADGFKRTVTYTADSINGF 103


>BT010217-1|AAQ23535.1|  194|Drosophila melanogaster RH05746p
           protein.
          Length = 194

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 24/65 (36%), Positives = 34/65 (52%)
 Frame = +3

Query: 423 YAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNA 602
           Y HPKY F Y VAD  +GD KSQHE+RDG +       ++       +     +   FNA
Sbjct: 30  YDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNA 89

Query: 603 IVSNT 617
           +V+ +
Sbjct: 90  VVTKS 94



 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 22/52 (42%), Positives = 32/52 (61%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVL 664
           D V G+Y+LVE DGS+R V+YTAD  HGF     +  P    Q ++  +P++
Sbjct: 59  DVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVV-ASPIV 109


>AE014296-370|AAF47579.2|  194|Drosophila melanogaster CG13935-PA
           protein.
          Length = 194

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 24/65 (36%), Positives = 34/65 (52%)
 Frame = +3

Query: 423 YAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTPLTTTTAFNA 602
           Y HPKY F Y VAD  +GD KSQHE+RDG +       ++       +     +   FNA
Sbjct: 30  YDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNA 89

Query: 603 IVSNT 617
           +V+ +
Sbjct: 90  VVTKS 94



 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 22/52 (42%), Positives = 32/52 (61%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVL 664
           D V G+Y+LVE DGS+R V+YTAD  HGF     +  P    Q ++  +P++
Sbjct: 59  DVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVV-ASPIV 109


>AM294620-1|CAL26618.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294619-1|CAL26617.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294618-1|CAL26616.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294617-1|CAL26615.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294616-1|CAL26614.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294615-1|CAL26613.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 19/30 (63%), Positives = 21/30 (70%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTA  H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTAYSHNGFQ 153


>AM294614-1|CAL26612.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294613-1|CAL26611.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294612-1|CAL26610.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294611-1|CAL26609.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294610-1|CAL26608.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AM294609-1|CAL26607.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AE014296-3162|AAF49153.1|  204|Drosophila melanogaster CG9283-PA
           protein.
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +3

Query: 405 AHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           +HHEE   HPKY+F Y V D  +GD K Q E+RDG
Sbjct: 89  SHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123



 Score = 45.6 bits (103), Expect = 8e-05
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G YT+ EADG  R VEYTAD H+GFQ
Sbjct: 124 DKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153


>AE014297-501|AAF54092.1|  217|Drosophila melanogaster CG1327-PA
           protein.
          Length = 217

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/40 (57%), Positives = 26/40 (65%), Gaps = 3/40 (7%)
 Frame = +3

Query: 399 VSAHHEEEYA---HPKYDFAYSVADGHSGDNKSQHESRDG 509
           +  H  E Y    HPKY+FAY V D  SGD+KSQ ESRDG
Sbjct: 49  IHPHGHEVYPDDPHPKYNFAYDVQDALSGDSKSQVESRDG 88



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPV 661
           D V GEY+L +ADG  R V+YTAD  +GF     +         ++  APV
Sbjct: 89  DVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVHHKVVAAAPV 139


>AE001572-15|AAD19805.1|  217|Drosophila melanogaster cuticle
           protein protein.
          Length = 217

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 23/40 (57%), Positives = 26/40 (65%), Gaps = 3/40 (7%)
 Frame = +3

Query: 399 VSAHHEEEYA---HPKYDFAYSVADGHSGDNKSQHESRDG 509
           +  H  E Y    HPKY+FAY V D  SGD+KSQ ESRDG
Sbjct: 49  IHPHGHEVYPDDPHPKYNFAYDVQDALSGDSKSQVESRDG 88



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPV 661
           D V GEY+L +ADG  R V+YTAD  +GF     +         ++  APV
Sbjct: 89  DVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVHHKVVAAAPV 139


>AE014296-3163|AAF49152.1|  198|Drosophila melanogaster CG9290-PA
           protein.
          Length = 198

 Score = 46.0 bits (104), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 23/29 (79%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+L E+DG+ R VEYTADDH+GF
Sbjct: 110 DKVKGSYSLKESDGTTRVVEYTADDHNGF 138



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/31 (58%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           E + +PKY F Y V D H+GD KSQ E+RDG
Sbjct: 79  EPHHYPKYQFDYGVKDAHTGDQKSQWETRDG 109


>BT022677-1|AAY55093.1|  202|Drosophila melanogaster IP07124p
           protein.
          Length = 202

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 26/69 (37%), Positives = 37/69 (53%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHS 473
           +A   + AA  + YA+P    AP  KV+A    V   A  E    +P+Y F+Y V D H+
Sbjct: 60  YAAPKLLAAPAISYAAPAISYAP--KVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHT 117

Query: 474 GDNKSQHES 500
           GD+K Q E+
Sbjct: 118 GDSKQQEET 126



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 17/27 (62%), Positives = 21/27 (77%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           VHG Y+L E DG++RKV YTAD  +GF
Sbjct: 132 VHGSYSLAEPDGTIRKVTYTADKVNGF 158


>AE014296-794|AAF47863.1|  188|Drosophila melanogaster CG15008-PA
           protein.
          Length = 188

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 26/69 (37%), Positives = 37/69 (53%)
 Frame = +3

Query: 294 HATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHS 473
           +A   + AA  + YA+P    AP  KV+A    V   A  E    +P+Y F+Y V D H+
Sbjct: 46  YAAPKLLAAPAISYAAPAISYAP--KVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHT 103

Query: 474 GDNKSQHES 500
           GD+K Q E+
Sbjct: 104 GDSKQQEET 112



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 17/27 (62%), Positives = 21/27 (77%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           VHG Y+L E DG++RKV YTAD  +GF
Sbjct: 118 VHGSYSLAEPDGTIRKVTYTADKVNGF 144


>AE014134-1731|AAN10713.1|  146|Drosophila melanogaster CG31876-PA
           protein.
          Length = 146

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 18/29 (62%), Positives = 24/29 (82%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+YTLV+ADG +R V+YT+D H+GF
Sbjct: 69  DQVQGQYTLVDADGYLRTVDYTSDAHNGF 97



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 25/50 (50%), Positives = 28/50 (56%)
 Frame = +3

Query: 360 PVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           P+    A   K L+     E  AH  YDFAYSV D H+GD KSQ ESR G
Sbjct: 21  PIYHSPAAIVKPLLKTVEVEAPAH--YDFAYSVHDEHTGDIKSQTESRKG 68


>BT023126-1|AAY55542.1|  245|Drosophila melanogaster IP08764p
           protein.
          Length = 245

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 29/79 (36%), Positives = 36/79 (45%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGH 470
           P   ++    AP H   P  Y AP  K  AP          E     PKY F Y + DG+
Sbjct: 31  PGPLHHYGGYAPQHGPLPGPYVAP--KPAAP----------EPYDPDPKYSFGYDIQDGY 78

Query: 471 SGDNKSQHESRDGTLCTAS 527
           +GD KSQHE+R G +   S
Sbjct: 79  TGDLKSQHETRHGDVVKGS 97



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y++V+ DG+ R V+YTAD HHGF
Sbjct: 92  DVVKGSYSVVDPDGTKRTVDYTADPHHGF 120


>BT023042-1|AAY55458.1|  245|Drosophila melanogaster IP08564p
           protein.
          Length = 245

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 29/79 (36%), Positives = 36/79 (45%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGH 470
           P   ++    AP H   P  Y AP  K  AP          E     PKY F Y + DG+
Sbjct: 31  PGPLHHYGGYAPQHGPLPGPYVAP--KPAAP----------EPYDPDPKYSFGYDIQDGY 78

Query: 471 SGDNKSQHESRDGTLCTAS 527
           +GD KSQHE+R G +   S
Sbjct: 79  TGDLKSQHETRHGDVVKGS 97



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y++V+ DG+ R V+YTAD HHGF
Sbjct: 92  DVVKGSYSVVDPDGTKRTVDYTADPHHGF 120


>AY070633-1|AAL48104.1|  192|Drosophila melanogaster RH01578p
           protein.
          Length = 192

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 25/57 (43%), Positives = 31/57 (54%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVLLGSSL 679
           D V G Y+L+EADG+ R VEYTAD  HGF       R     + + P A VL  + L
Sbjct: 84  DVVQGAYSLIEADGTRRIVEYTADPVHGFNAV--VRREGAVVKAVAPVAKVLAPAPL 138



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +3

Query: 336 ASPVHYAAP-VAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           A P + + P +AKV AP   V   A  E    +P+Y F+Y V DG +GD KSQ E+R G
Sbjct: 27  ALPAYPSYPALAKVAAPL--VAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSG 83


>AE014297-2676|AAF55678.2|  245|Drosophila melanogaster CG6240-PA
           protein.
          Length = 245

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 29/79 (36%), Positives = 36/79 (45%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGH 470
           P   ++    AP H   P  Y AP  K  AP          E     PKY F Y + DG+
Sbjct: 31  PGPLHHYGGYAPQHGPLPGPYVAP--KPAAP----------EPYDPDPKYSFGYDIQDGY 78

Query: 471 SGDNKSQHESRDGTLCTAS 527
           +GD KSQHE+R G +   S
Sbjct: 79  TGDLKSQHETRHGDVVKGS 97



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y++V+ DG+ R V+YTAD HHGF
Sbjct: 92  DVVKGSYSVVDPDGTKRTVDYTADPHHGF 120


>AE014296-793|AAF47862.1|  147|Drosophila melanogaster CG15007-PA
           protein.
          Length = 147

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 5/94 (5%)
 Frame = +3

Query: 261 SSQTILRHDQPHATNY-----IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEY 425
           SS +I++H  P   +Y     + A   +        AA    ++  A  V V  + E + 
Sbjct: 6   SSDSIVKHKAPLENHYPPANLVMALIKITLICCALIAAIECALLPAAVPVGVPLNTEVD- 64

Query: 426 AHPKYDFAYSVADGHSGDNKSQHESRDGTLCTAS 527
            HP+Y FAY+V D  +GD+KSQ E RDG +   S
Sbjct: 65  PHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGS 98



 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHR-PRFTTQLMLPTAPVLLG 670
           D V G Y++V+ADGS+R V YTAD  +GF    Q+   P     L+ P A  +LG
Sbjct: 93  DVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPVPVAARPLVAPVAAPILG 147


>AE014296-792|AAF47861.1|  192|Drosophila melanogaster CG15006-PA
           protein.
          Length = 192

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 25/57 (43%), Positives = 31/57 (54%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVLLGSSL 679
           D V G Y+L+EADG+ R VEYTAD  HGF       R     + + P A VL  + L
Sbjct: 84  DVVQGAYSLIEADGTRRIVEYTADPVHGFNAV--VRREGAVVKAVAPVAKVLAPAPL 138



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +3

Query: 336 ASPVHYAAP-VAKVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           A P + + P +AKV AP   V   A  E    +P+Y F+Y V DG +GD KSQ E+R G
Sbjct: 27  ALPAYPSYPALAKVAAPL--VAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSG 83


>BT022916-1|AAY55332.1|  136|Drosophila melanogaster IP04416p
           protein.
          Length = 136

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHR-PRFTTQLMLPTAPVLLG 670
           D V G Y++V+ADGS+R V YTAD  +GF    Q+   P     L+ P A  +LG
Sbjct: 82  DVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPVPVAARPLVAPVAAPILG 136



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = +3

Query: 429 HPKYDFAYSVADGHSGDNKSQHESRDGTLCTAS 527
           HP+Y FAY+V D  +GD+KSQ E RDG +   S
Sbjct: 55  HPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGS 87


>AY121656-1|AAM51983.1|  206|Drosophila melanogaster RE04513p
           protein.
          Length = 206

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 1/46 (2%)
 Frame = +3

Query: 375 IAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           I PA   L +    EEY  HP+Y + Y V D  SGD+K+Q E+R+G
Sbjct: 35  IIPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREG 80



 Score = 35.9 bits (79), Expect = 0.064
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+Y+L +ADG  R V+YTAD  +GF
Sbjct: 81  DVVQGQYSLNDADGYRRIVDYTADPINGF 109



 Score = 32.7 bits (71), Expect = 0.59
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYA---SPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAY 452
           P  T Y AA AP+ YA   +P+ YAAP   V A        A  + ++A P   +AY
Sbjct: 150 PLTTTYAAAPAPLAYAAAPAPLAYAAPAPVVKAAPLVAAGPAIVKTQFASPLISYAY 206


>AE014297-497|AAF54096.1|  191|Drosophila melanogaster CG2342-PA
           protein.
          Length = 191

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 1/46 (2%)
 Frame = +3

Query: 375 IAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           I PA   L +    EEY  HP+Y + Y V D  SGD+K+Q E+R+G
Sbjct: 20  IIPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREG 65



 Score = 35.9 bits (79), Expect = 0.064
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+Y+L +ADG  R V+YTAD  +GF
Sbjct: 66  DVVQGQYSLNDADGYRRIVDYTADPINGF 94



 Score = 32.7 bits (71), Expect = 0.59
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYA---SPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAY 452
           P  T Y AA AP+ YA   +P+ YAAP   V A        A  + ++A P   +AY
Sbjct: 135 PLTTTYAAAPAPLAYAAAPAPLAYAAPAPVVKAAPLVAAGPAIVKTQFASPLISYAY 191


>AE001572-19|AAD19809.1|  191|Drosophila melanogaster cuticle
           protein protein.
          Length = 191

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 1/46 (2%)
 Frame = +3

Query: 375 IAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           I PA   L +    EEY  HP+Y + Y V D  SGD+K+Q E+R+G
Sbjct: 20  IIPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREG 65



 Score = 35.9 bits (79), Expect = 0.064
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G+Y+L +ADG  R V+YTAD  +GF
Sbjct: 66  DVVQGQYSLNDADGYRRIVDYTADPINGF 94



 Score = 32.7 bits (71), Expect = 0.59
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
 Frame = +3

Query: 291 PHATNYIAAAAPVHYA---SPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYDFAY 452
           P  T Y AA AP+ YA   +P+ YAAP   V A        A  + ++A P   +AY
Sbjct: 135 PLTTTYAAAPAPLAYAAAPAPLAYAAPAPVVKAAPLVAAGPAIVKTQFASPLISYAY 191


>M71249-1|AAA28501.1|  188|Drosophila melanogaster cuticle protein
           protein.
          Length = 188

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 20/37 (54%), Positives = 25/37 (67%), Gaps = 1/37 (2%)
 Frame = +3

Query: 402 SAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           S+  E+ Y +HP+Y F Y V D  +GD KSQ ESRDG
Sbjct: 24  SSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDG 60



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y++ +ADG  R V+YTADD  GF
Sbjct: 61  DVVHGQYSVNDADGYRRTVDYTADDVRGF 89


>AE014297-496|AAF54097.2|  188|Drosophila melanogaster CG2345-PA
           protein.
          Length = 188

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 20/37 (54%), Positives = 25/37 (67%), Gaps = 1/37 (2%)
 Frame = +3

Query: 402 SAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           S+  E+ Y +HP+Y F Y V D  +GD KSQ ESRDG
Sbjct: 24  SSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDG 60



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y++ +ADG  R V+YTADD  GF
Sbjct: 61  DVVHGQYSVNDADGYRRTVDYTADDVRGF 89


>AE001572-20|AAD19810.1|  188|Drosophila melanogaster
           pupal-cuticle-protein protein.
          Length = 188

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 20/37 (54%), Positives = 25/37 (67%), Gaps = 1/37 (2%)
 Frame = +3

Query: 402 SAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDG 509
           S+  E+ Y +HP+Y F Y V D  +GD KSQ ESRDG
Sbjct: 24  SSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDG 60



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D VHG+Y++ +ADG  R V+YTADD  GF
Sbjct: 61  DVVHGQYSVNDADGYRRTVDYTADDVRGF 89


>Y18453-1|CAA77177.1|  472|Drosophila melanogaster drosocrystallin
           protein.
          Length = 472

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = +3

Query: 399 VSAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTP 575
           ++ +  E+Y   P+Y FAY V D  +GD+K Q E RDG L       ++       +   
Sbjct: 63  LAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYT 122

Query: 576 LTTTTAFNAIVS 611
               + FNAIVS
Sbjct: 123 ADDVSGFNAIVS 134



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHR 619
           D V G+Y+L+E DG+ R VEYTADD  GF     + R
Sbjct: 101 DLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQR 137


>AY119178-1|AAM51038.1|  477|Drosophila melanogaster RH66281p
           protein.
          Length = 477

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = +3

Query: 399 VSAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTP 575
           ++ +  E+Y   P+Y FAY V D  +GD+K Q E RDG L       ++       +   
Sbjct: 63  LAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYT 122

Query: 576 LTTTTAFNAIVS 611
               + FNAIVS
Sbjct: 123 ADDVSGFNAIVS 134



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHR 619
           D V G+Y+L+E DG+ R VEYTADD  GF     + R
Sbjct: 101 DLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQR 137


>AE014134-2114|AAF53134.2|  477|Drosophila melanogaster CG16963-PA
           protein.
          Length = 477

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = +3

Query: 399 VSAHHEEEY-AHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARLSTP 575
           ++ +  E+Y   P+Y FAY V D  +GD+K Q E RDG L       ++       +   
Sbjct: 63  LAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYT 122

Query: 576 LTTTTAFNAIVS 611
               + FNAIVS
Sbjct: 123 ADDVSGFNAIVS 134



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHR 619
           D V G+Y+L+E DG+ R VEYTADD  GF     + R
Sbjct: 101 DLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQR 137


>BT024343-1|ABC86405.1|  266|Drosophila melanogaster IP09562p
           protein.
          Length = 266

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 17/30 (56%), Positives = 24/30 (80%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G Y++V+ DG++R V+YTADD +GFQ
Sbjct: 127 DEVRGVYSVVDPDGTLRVVKYTADDANGFQ 156



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHSGDNK 485
           I A A V Y+    YA     V+ P H V V      +Y A P+Y FAY V DG +   +
Sbjct: 63  IGACAAVGYS----YARFEGPVVGPEHLVTVHDGRTVDYVARPEYSFAYGVEDGKTRVLQ 118

Query: 486 SQHESRDG 509
           ++ E+R+G
Sbjct: 119 NRKETRNG 126


>AE014296-1421|AAF50444.1|  266|Drosophila melanogaster CG13670-PA
           protein.
          Length = 266

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 17/30 (56%), Positives = 24/30 (80%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQ 598
           D V G Y++V+ DG++R V+YTADD +GFQ
Sbjct: 127 DEVRGVYSVVDPDGTLRVVKYTADDANGFQ 156



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEY-AHPKYDFAYSVADGHSGDNK 485
           I A A V Y+    YA     V+ P H V V      +Y A P+Y FAY V DG +   +
Sbjct: 63  IGACAAVGYS----YARFEGPVVGPEHLVTVHDGRTVDYVARPEYSFAYGVEDGKTRVLQ 118

Query: 486 SQHESRDG 509
           ++ E+R+G
Sbjct: 119 NRKETRNG 126


>AE014134-1730|AAN10712.1|  146|Drosophila melanogaster CG31878-PA,
           isoform A protein.
          Length = 146

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +3

Query: 396 LVSAHHEEEYAHP-KYDFAYSVADGHSGDNKSQHESRDGTLCT 521
           ++++H +E  A P +Y+F YSV D HSGD K Q E R G   T
Sbjct: 67  IIASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVT 109



 Score = 31.5 bits (68), Expect = 1.4
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           V G Y+LV+ DG  R V+YTAD   GF
Sbjct: 108 VTGRYSLVDPDGHRRIVDYTADPLLGF 134


>AE014134-1729|AAN10711.1|  106|Drosophila melanogaster CG31878-PB,
           isoform B protein.
          Length = 106

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +3

Query: 396 LVSAHHEEEYAHP-KYDFAYSVADGHSGDNKSQHESRDGTLCT 521
           ++++H +E  A P +Y+F YSV D HSGD K Q E R G   T
Sbjct: 27  IIASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVT 69



 Score = 31.5 bits (68), Expect = 1.4
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           V G Y+LV+ DG  R V+YTAD   GF
Sbjct: 68  VTGRYSLVDPDGHRRIVDYTADPLLGF 94


>BT022412-1|AAY54828.1|  424|Drosophila melanogaster IP11572p
           protein.
          Length = 424

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +3

Query: 423 YAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           Y H  Y F+Y V D H+GD KSQ ESRDG
Sbjct: 51  YEHQGYAFSYGVKDLHTGDVKSQWESRDG 79



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+++E DGS+R V YTAD   GF
Sbjct: 80  DGVKGHYSVLEPDGSIRTVHYTADAKKGF 108


>BT022352-1|AAY54768.1|  424|Drosophila melanogaster IP11272p
           protein.
          Length = 424

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +3

Query: 423 YAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           Y H  Y F+Y V D H+GD KSQ ESRDG
Sbjct: 51  YEHQGYAFSYGVKDLHTGDVKSQWESRDG 79



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+++E DGS+R V YTAD   GF
Sbjct: 80  DGVKGHYSVLEPDGSIRTVHYTADAKKGF 108


>BT022288-1|AAY54704.1|  424|Drosophila melanogaster IP11372p
           protein.
          Length = 424

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +3

Query: 423 YAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           Y H  Y F+Y V D H+GD KSQ ESRDG
Sbjct: 51  YEHQGYAFSYGVKDLHTGDVKSQWESRDG 79



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+++E DGS+R V YTAD   GF
Sbjct: 80  DGVKGHYSVLEPDGSIRTVHYTADAKKGF 108


>BT022236-1|AAY54652.1|  424|Drosophila melanogaster IP11472p
           protein.
          Length = 424

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +3

Query: 423 YAHPKYDFAYSVADGHSGDNKSQHESRDG 509
           Y H  Y F+Y V D H+GD KSQ ESRDG
Sbjct: 51  YEHQGYAFSYGVKDLHTGDVKSQWESRDG 79



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+++E DGS+R V YTAD   GF
Sbjct: 80  DGVKGHYSVLEPDGSIRTVHYTADAKKGF 108


>AE014134-1650|AAF52783.2|  153|Drosophila melanogaster CG3818-PA
           protein.
          Length = 153

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 21/50 (42%), Positives = 29/50 (58%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAP 658
           D V G Y L+++DG  R V+Y ADDH+GF+   Q  R     ++ LP  P
Sbjct: 57  DKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQ--REPTDIKIPLPEPP 104



 Score = 35.9 bits (79), Expect = 0.064
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESR 503
           E +Y    Y+F +SV D H+GD KSQ ESR
Sbjct: 25  EPDYGPVAYEFQWSVNDPHTGDIKSQKESR 54


>AE014297-2840|AAF55794.1|  381|Drosophila melanogaster CG5494-PA
           protein.
          Length = 381

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 15/26 (57%), Positives = 18/26 (69%)
 Frame = +2

Query: 518 HGEYTLVEADGSVRKVEYTADDHHGF 595
           HG Y+ V+  G V+ V YTAD HHGF
Sbjct: 59  HGSYSYVDGHGHVQSVSYTADPHHGF 84


>AE014134-2498|AAF53397.1|  218|Drosophila melanogaster CG3474-PA
           protein.
          Length = 218

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 18/38 (47%), Positives = 22/38 (57%)
 Frame = +3

Query: 408 HHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCT 521
           H +   +H +YDF Y V D  +GD KSQ ESR G   T
Sbjct: 62  HDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVT 99



 Score = 39.1 bits (87), Expect = 0.007
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRY 604
           V G Y L++ADG  R V YTAD H GF+ +
Sbjct: 98  VTGHYELIDADGHKRTVHYTADKHKGFEAH 127


>BT022990-1|AAY55406.1|  155|Drosophila melanogaster IP08464p
           protein.
          Length = 155

 Score = 38.7 bits (86), Expect = 0.009
 Identities = 14/24 (58%), Positives = 20/24 (83%)
 Frame = +2

Query: 524 EYTLVEADGSVRKVEYTADDHHGF 595
           +Y++V+ DG+ R V+YTAD HHGF
Sbjct: 7   DYSVVDPDGTKRTVDYTADPHHGF 30


>AE014296-3164|AAF49151.1|  401|Drosophila melanogaster CG9295-PB
           protein.
          Length = 401

 Score = 38.7 bits (86), Expect = 0.009
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDHHGF 595
           D V G Y+++E DGS+R V YTAD   GF
Sbjct: 57  DGVKGHYSVLEPDGSIRTVHYTADAKKGF 85



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 17/27 (62%), Positives = 19/27 (70%)
 Frame = +3

Query: 429 HPKYDFAYSVADGHSGDNKSQHESRDG 509
           H  Y F+Y V D H+GD KSQ ESRDG
Sbjct: 30  HQGYAFSYGVKDLHTGDVKSQWESRDG 56


>AY071231-1|AAL48853.1|  217|Drosophila melanogaster RE26879p
           protein.
          Length = 217

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTL 515
           EE+Y   KY+F Y V D  SG++    ESRDG L
Sbjct: 120 EEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDL 153


>AE013599-2993|AAF57484.2|  217|Drosophila melanogaster CG9036-PA
           protein.
          Length = 217

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +3

Query: 414 EEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTL 515
           EE+Y   KY+F Y V D  SG++    ESRDG L
Sbjct: 120 EEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDL 153


>AY071302-1|AAL48924.1|  302|Drosophila melanogaster RE33041p
           protein.
          Length = 302

 Score = 37.5 bits (83), Expect = 0.021
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           V G Y+L++ DG  R V YTADD HGF
Sbjct: 183 VRGFYSLIDPDGYKRTVTYTADDVHGF 209



 Score = 32.7 bits (71), Expect = 0.59
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = +3

Query: 408 HHEEEYAHP-KYDFAYSVADGHSGDNKSQHESRDG 509
           H E E   P  Y F Y+V D  +GD K   E+RDG
Sbjct: 146 HQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDG 180


>AE014134-486|AAF51198.2|  302|Drosophila melanogaster CG2973-PA
           protein.
          Length = 302

 Score = 37.5 bits (83), Expect = 0.021
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGF 595
           V G Y+L++ DG  R V YTADD HGF
Sbjct: 183 VRGFYSLIDPDGYKRTVTYTADDVHGF 209



 Score = 32.7 bits (71), Expect = 0.59
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = +3

Query: 408 HHEEEYAHP-KYDFAYSVADGHSGDNKSQHESRDG 509
           H E E   P  Y F Y+V D  +GD K   E+RDG
Sbjct: 146 HQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDG 180


>AY071527-1|AAL49149.1|  270|Drosophila melanogaster RE57183p
           protein.
          Length = 270

 Score = 36.3 bits (80), Expect = 0.048
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVLL 667
           + G Y++V++DG +R V+YTAD   GF+    +       ++  P  P  L
Sbjct: 184 IKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTDIVVKIPTPPPPTQL 234



 Score = 32.3 bits (70), Expect = 0.79
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 4/76 (5%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKVIAPA-HKV-LVSAHHEEEY--AHPKYDFAYSVADGHSGD 479
           AA  P        Y AP   ++    HK+ L   + EEEY   +  Y F + V D    +
Sbjct: 112 AAPQPPRRIQQSSYQAPSTSILGKGQHKLSLQQQNEEEEYDDQNSSYQFGFDVKDDEFTN 171

Query: 480 NKSQHESRDGTLCTAS 527
            +++ E RDG++   S
Sbjct: 172 YQNRKEIRDGSVIKGS 187


>AE014296-1500|AAF50383.2|  270|Drosophila melanogaster CG32029-PA
           protein.
          Length = 270

 Score = 36.3 bits (80), Expect = 0.048
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +2

Query: 515 VHGEYTLVEADGSVRKVEYTADDHHGFQRYRQQHRPRFTTQLMLPTAPVLL 667
           + G Y++V++DG +R V+YTAD   GF+    +       ++  P  P  L
Sbjct: 184 IKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTDIVVKIPTPPPPTQL 234



 Score = 32.3 bits (70), Expect = 0.79
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 4/76 (5%)
 Frame = +3

Query: 312 AAAAPVHYASPVHYAAPVAKVIAPA-HKV-LVSAHHEEEY--AHPKYDFAYSVADGHSGD 479
           AA  P        Y AP   ++    HK+ L   + EEEY   +  Y F + V D    +
Sbjct: 112 AAPQPPRRIQQSSYQAPSTSILGKGQHKLSLQQQNEEEEYDDQNSSYQFGFDVKDDEFTN 171

Query: 480 NKSQHESRDGTLCTAS 527
            +++ E RDG++   S
Sbjct: 172 YQNRKEIRDGSVIKGS 187


>AY089582-1|AAL90320.1|  304|Drosophila melanogaster RE11615p
           protein.
          Length = 304

 Score = 33.5 bits (73), Expect = 0.34
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 27  SLERCAGSECSRSPTGAAIFFSCG-CLFSEHRPSRPATAPC 146
           +LERC G+ C RSP G   + SCG C          A +PC
Sbjct: 6   ALERCPGAYCGRSPLGNNSWSSCGVCPRGSRVNQSYACSPC 46


>AE014297-4808|AAF57197.2|  304|Drosophila melanogaster CG2126-PA
           protein.
          Length = 304

 Score = 33.5 bits (73), Expect = 0.34
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 27  SLERCAGSECSRSPTGAAIFFSCG-CLFSEHRPSRPATAPC 146
           +LERC G+ C RSP G   + SCG C          A +PC
Sbjct: 6   ALERCPGAYCGRSPLGNNSWSSCGVCPRGSRVNQSYACSPC 46


>BT011532-1|AAS15668.1|  131|Drosophila melanogaster RE06402p
           protein.
          Length = 131

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           +A  AP+ Y++P+ Y+AP A V APA  V  ++
Sbjct: 26  LAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATS 58


>AY071430-1|AAL49052.1|  141|Drosophila melanogaster RE51966p
           protein.
          Length = 141

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           +A  AP+ Y++P+ Y+AP A V APA  V  ++
Sbjct: 26  LAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATS 58


>AE014296-3153|AAF49158.2|  141|Drosophila melanogaster CG18294-PA
           protein.
          Length = 141

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           +A  AP+ Y++P+ Y+AP A V APA  V  ++
Sbjct: 26  LAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATS 58


>AE014296-3152|AAF49159.2|  131|Drosophila melanogaster CG12519-PA
           protein.
          Length = 131

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           +A  AP+ Y++P+ Y+AP A V APA  V  ++
Sbjct: 26  LAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATS 58


>AE014296-3149|AAF49160.1|  122|Drosophila melanogaster CG14096-PA
           protein.
          Length = 122

 Score = 31.9 bits (69), Expect = 1.0
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           +A  AP+ Y++P+ Y+AP A V APA  V  ++
Sbjct: 26  LAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATS 58



 Score = 31.1 bits (67), Expect = 1.8
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = +3

Query: 318 AAPVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           AAP  YASP+ Y+AP+A     A+K L +A
Sbjct: 88  AAPFAYASPLAYSAPLAYTSPLAYKTLPAA 117


>AE014296-861|AAF47911.2|  456|Drosophila melanogaster CG11350-PB
           protein.
          Length = 456

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 4/71 (5%)
 Frame = +3

Query: 261 SSQTILRHDQPHATNY-IAAAAP-VHYASP-VHYAAPVAKVIAPAHKVLVSAHHEE-EYA 428
           +S  +  +  P  ++Y +AA+AP V YA+P V YAAP     APA     +A      YA
Sbjct: 51  ASAPVASYSAPVESSYSVAASAPAVSYAAPAVSYAAPAQSYSAPAATYTAAASAPAVSYA 110

Query: 429 HPKYDFAYSVA 461
            P   ++   A
Sbjct: 111 APAQSYSAPAA 121


>AE014134-2140|AAF53151.1|   69|Drosophila melanogaster CG6770-PA
           protein.
          Length = 69

 Score = 31.1 bits (67), Expect = 1.8
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = +3

Query: 399 VSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGT 512
           +S  H +EY H  +D    +  GHSG  +++ E+ + T
Sbjct: 1   MSEAHFDEYEHYNFDHDKHIFSGHSGKQRNKREANEHT 38


>AY071659-1|AAL49281.1|  436|Drosophila melanogaster RE74364p
           protein.
          Length = 436

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +2

Query: 587 HGFQRYRQQHRPRFTTQLML 646
           HGFQ+++QQH  RF +QL L
Sbjct: 223 HGFQQHQQQHSNRFESQLPL 242


>AL121806-10|CAB58085.1|  692|Drosophila melanogaster EG:BACR42I17.9
           protein.
          Length = 692

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +2

Query: 587 HGFQRYRQQHRPRFTTQLML 646
           HGFQ+++QQH  RF +QL L
Sbjct: 223 HGFQQHQQQHSNRFESQLPL 242


>AE014298-161|AAF45593.2|  436|Drosophila melanogaster CG11381-PA
           protein.
          Length = 436

 Score = 30.7 bits (66), Expect = 2.4
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +2

Query: 587 HGFQRYRQQHRPRFTTQLML 646
           HGFQ+++QQH  RF +QL L
Sbjct: 223 HGFQQHQQQHSNRFESQLPL 242


>AE014296-3145|AAS64972.1|  255|Drosophila melanogaster CG33255-PA
           protein.
          Length = 255

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           +A   P+ Y++P+ Y+AP A V APA  V  ++
Sbjct: 90  LAYTGPLAYSAPLAYSAPAAVVAAPAPVVTATS 122


>AE014296-2697|AAF49491.2|  155|Drosophila melanogaster CG13059-PA
           protein.
          Length = 155

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +3

Query: 309 IAAAAPVHYASPVHYAAPVAKVIAPA 386
           +  +APV +A+PV +AAP+ K + PA
Sbjct: 61  VVYSAPVVHAAPVVHAAPLVKTVIPA 86


>AE014296-3154|AAN11648.1|  154|Drosophila melanogaster CG32213-PA
           protein.
          Length = 154

 Score = 29.9 bits (64), Expect = 4.2
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +3

Query: 321 APVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           AP+ Y +P+ Y+AP A V APA  V  ++
Sbjct: 49  APLAYTAPLAYSAPAAVVAAPAPVVTATS 77


>AE014296-3151|AAN11647.1|  154|Drosophila melanogaster CG32208-PA
           protein.
          Length = 154

 Score = 29.9 bits (64), Expect = 4.2
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +3

Query: 321 APVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           AP+ Y +P+ Y+AP A V APA  V  ++
Sbjct: 49  APLAYTAPLAYSAPAAVVAAPAPVVTATS 77


>AE014296-3150|AAN11646.1|  141|Drosophila melanogaster CG32214-PA
           protein.
          Length = 141

 Score = 29.9 bits (64), Expect = 4.2
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +3

Query: 321 APVHYASPVHYAAPVAKVIAPAHKVLVSA 407
           AP+ Y +P+ Y+AP A V APA  V  ++
Sbjct: 49  APLAYTAPLAYSAPAAVVAAPAPVVTATS 77


>AE013599-3864|AAF47201.1|  830|Drosophila melanogaster CG3419-PA,
           isoform A protein.
          Length = 830

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = +3

Query: 300 TNYIAAAA-PVHYASPVHYAAPVA--KVIAPAHKVLVSA 407
           T Y AA A    YA+PV Y+APVA     APA+    +A
Sbjct: 725 TTYAAAPAYAASYAAPVAYSAPVATYAAAAPAYSTYAAA 763


>AE013599-3461|AAF46899.2| 1218|Drosophila melanogaster CG3536-PA
            protein.
          Length = 1218

 Score = 29.5 bits (63), Expect = 5.5
 Identities = 24/88 (27%), Positives = 33/88 (37%), Gaps = 7/88 (7%)
 Frame = +3

Query: 255  AVSSQTILRHDQPHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHP 434
            A+  Q      QPH       ++  H  SP  YA  +A+       V  SAH  EE    
Sbjct: 1002 ALQQQHQASQQQPHRQESTQTSSQTHGYSPRSYADRLARATDSPRSVSPSAHGSEERPRS 1061

Query: 435  KYDFAYSVA-------DGHSGDNKSQHE 497
            +    +S+         GH  D+ SQ E
Sbjct: 1062 RTTSHHSIRPQSQPSHTGHICDSSSQLE 1089


>AY071448-1|AAL49070.1|  815|Drosophila melanogaster RE53044p
           protein.
          Length = 815

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = +3

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRD 506
           ++YA  KY+F Y + D H+G++    ++RD
Sbjct: 745 QQYAS-KYEFGYRIRDFHTGNDFGHKQNRD 773


>AE013599-1762|AAF58339.2|  815|Drosophila melanogaster CG13338-PA
           protein.
          Length = 815

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = +3

Query: 417 EEYAHPKYDFAYSVADGHSGDNKSQHESRD 506
           ++YA  KY+F Y + D H+G++    ++RD
Sbjct: 745 QQYAS-KYEFGYRIRDFHTGNDFGHKQNRD 773


>AE013599-1477|AAF58517.1|  126|Drosophila melanogaster CG8510-PA
           protein.
          Length = 126

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +2

Query: 509 DAVHGEYTLVEADGSVRKVEYTADDH 586
           ++V+G+Y+ V  DG    V YTAD++
Sbjct: 63  ESVNGKYSFVADDGKTYVVSYTADEN 88


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,966,613
Number of Sequences: 53049
Number of extensions: 370922
Number of successful extensions: 2002
Number of sequences better than 10.0: 103
Number of HSP's better than 10.0 without gapping: 1665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1966
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3695805360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).