SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30006
         (796 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY058597-1|AAL13826.1|  607|Drosophila melanogaster LD29172p pro...    30   3.2  
AE014296-2838|AAN11720.1|  607|Drosophila melanogaster CG11905-P...    30   3.2  
AE014296-2837|AAN11719.1|  607|Drosophila melanogaster CG11905-P...    30   3.2  
AE014296-2836|AAF49392.3|  607|Drosophila melanogaster CG11905-P...    30   3.2  
AE014296-3448|AAF51661.2| 1058|Drosophila melanogaster CG10588-P...    29   7.3  
AY118402-1|AAM48431.1|  606|Drosophila melanogaster RE60936p pro...    29   9.7  
AF288482-1|AAG01528.1|  606|Drosophila melanogaster atypical pro...    29   9.7  
AE013599-1993|ABI31091.1|  503|Drosophila melanogaster CG10261-P...    29   9.7  
AE013599-1992|ABI31093.1|  526|Drosophila melanogaster CG10261-P...    29   9.7  
AE013599-1991|ABI31092.1|  524|Drosophila melanogaster CG10261-P...    29   9.7  
AE013599-1990|ABI31094.1|  608|Drosophila melanogaster CG10261-P...    29   9.7  
AE013599-1989|ABI31090.1|  606|Drosophila melanogaster CG10261-P...    29   9.7  
AE013599-1988|AAF58177.2|  606|Drosophila melanogaster CG10261-P...    29   9.7  

>AY058597-1|AAL13826.1|  607|Drosophila melanogaster LD29172p
           protein.
          Length = 607

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +3

Query: 84  TKTPVPRKFPTWRIDTRPSPLAFYKPQR 167
           TK PVP  F  +R+D+R  P+  +KPQ+
Sbjct: 265 TKAPVPVNFKEYRLDSREKPV--HKPQK 290


>AE014296-2838|AAN11720.1|  607|Drosophila melanogaster CG11905-PG,
           isoform G protein.
          Length = 607

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +3

Query: 84  TKTPVPRKFPTWRIDTRPSPLAFYKPQR 167
           TK PVP  F  +R+D+R  P+  +KPQ+
Sbjct: 265 TKAPVPVNFKEYRLDSREKPV--HKPQK 290


>AE014296-2837|AAN11719.1|  607|Drosophila melanogaster CG11905-PD,
           isoform D protein.
          Length = 607

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +3

Query: 84  TKTPVPRKFPTWRIDTRPSPLAFYKPQR 167
           TK PVP  F  +R+D+R  P+  +KPQ+
Sbjct: 265 TKAPVPVNFKEYRLDSREKPV--HKPQK 290


>AE014296-2836|AAF49392.3|  607|Drosophila melanogaster CG11905-PA,
           isoform A protein.
          Length = 607

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +3

Query: 84  TKTPVPRKFPTWRIDTRPSPLAFYKPQR 167
           TK PVP  F  +R+D+R  P+  +KPQ+
Sbjct: 265 TKAPVPVNFKEYRLDSREKPV--HKPQK 290


>AE014296-3448|AAF51661.2| 1058|Drosophila melanogaster CG10588-PA
           protein.
          Length = 1058

 Score = 29.1 bits (62), Expect = 7.3
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = +1

Query: 241 SLCCYCRDHIWLISIV 288
           SLC Y R H+W IS+V
Sbjct: 355 SLCAYLRHHLWCISVV 370


>AY118402-1|AAM48431.1|  606|Drosophila melanogaster RE60936p
           protein.
          Length = 606

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 151 SISLRGIRPTRSLVFIATNNIGTSK*THTTSLCCYCRDHIW 273
           SI  RG R  R L +    +I  +K  +  + C YC+D IW
Sbjct: 128 SIYRRGARRWRKL-YRVNGHIFQAKRFNRRAFCAYCQDRIW 167


>AF288482-1|AAG01528.1|  606|Drosophila melanogaster atypical
           protein kinase C protein.
          Length = 606

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 151 SISLRGIRPTRSLVFIATNNIGTSK*THTTSLCCYCRDHIW 273
           SI  RG R  R L +    +I  +K  +  + C YC+D IW
Sbjct: 128 SIYRRGARRWRKL-YRVNGHIFQAKRFNRRAFCAYCQDRIW 167


>AE013599-1993|ABI31091.1|  503|Drosophila melanogaster CG10261-PF,
           isoform F protein.
          Length = 503

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 151 SISLRGIRPTRSLVFIATNNIGTSK*THTTSLCCYCRDHIW 273
           SI  RG R  R L +    +I  +K  +  + C YC+D IW
Sbjct: 25  SIYRRGARRWRKL-YRVNGHIFQAKRFNRRAFCAYCQDRIW 64


>AE013599-1992|ABI31093.1|  526|Drosophila melanogaster CG10261-PB,
           isoform B protein.
          Length = 526

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 151 SISLRGIRPTRSLVFIATNNIGTSK*THTTSLCCYCRDHIW 273
           SI  RG R  R L +    +I  +K  +  + C YC+D IW
Sbjct: 46  SIYRRGARRWRKL-YRVNGHIFQAKRFNRRAFCAYCQDRIW 85


>AE013599-1991|ABI31092.1|  524|Drosophila melanogaster CG10261-PE,
           isoform E protein.
          Length = 524

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 151 SISLRGIRPTRSLVFIATNNIGTSK*THTTSLCCYCRDHIW 273
           SI  RG R  R L +    +I  +K  +  + C YC+D IW
Sbjct: 46  SIYRRGARRWRKL-YRVNGHIFQAKRFNRRAFCAYCQDRIW 85


>AE013599-1990|ABI31094.1|  608|Drosophila melanogaster CG10261-PD,
           isoform D protein.
          Length = 608

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 151 SISLRGIRPTRSLVFIATNNIGTSK*THTTSLCCYCRDHIW 273
           SI  RG R  R L +    +I  +K  +  + C YC+D IW
Sbjct: 128 SIYRRGARRWRKL-YRVNGHIFQAKRFNRRAFCAYCQDRIW 167


>AE013599-1989|ABI31090.1|  606|Drosophila melanogaster CG10261-PC,
           isoform C protein.
          Length = 606

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 151 SISLRGIRPTRSLVFIATNNIGTSK*THTTSLCCYCRDHIW 273
           SI  RG R  R L +    +I  +K  +  + C YC+D IW
Sbjct: 128 SIYRRGARRWRKL-YRVNGHIFQAKRFNRRAFCAYCQDRIW 167


>AE013599-1988|AAF58177.2|  606|Drosophila melanogaster CG10261-PA,
           isoform A protein.
          Length = 606

 Score = 28.7 bits (61), Expect = 9.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 151 SISLRGIRPTRSLVFIATNNIGTSK*THTTSLCCYCRDHIW 273
           SI  RG R  R L +    +I  +K  +  + C YC+D IW
Sbjct: 128 SIYRRGARRWRKL-YRVNGHIFQAKRFNRRAFCAYCQDRIW 167


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,605,716
Number of Sequences: 53049
Number of extensions: 576672
Number of successful extensions: 1116
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1090
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1116
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3695805360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).