SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30005
         (981 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ062786-1|AAY56659.1|  489|Drosophila melanogaster Erp60 protein.     42   0.002
AY060296-1|AAL25335.1|  364|Drosophila melanogaster GH13982p pro...    42   0.002
AE013599-1356|AAM68697.1|  364|Drosophila melanogaster CG8983-PB...    42   0.002
AE013599-1355|AAF58609.2|  489|Drosophila melanogaster CG8983-PA...    42   0.002

>DQ062786-1|AAY56659.1|  489|Drosophila melanogaster Erp60 protein.
          Length = 489

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 27/76 (35%), Positives = 37/76 (48%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADGKQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP* 228
           LNE+G DF  GDKPVV  RD    +   +   S   +    ++  +  +LEP++K   P 
Sbjct: 302 LNEYGYDFV-GDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLA-NELEPYIKSE-PI 358

Query: 229 PGKRTGPVK*PFGKNF 276
           P     PVK    KNF
Sbjct: 359 PESNDAPVKVAVAKNF 374



 Score = 32.3 bits (70), Expect = 1.0
 Identities = 44/191 (23%), Positives = 76/191 (39%), Gaps = 2/191 (1%)
 Frame = +3

Query: 3   EATFAVSDKDDFTHAAQXXXXXXXXXXXXXXXXXXXXXQTNSS*DAEFSIENLLTFTKDL 182
           +  FA++ KDDF H  +                         +   EFS+ENL  F + L
Sbjct: 287 QINFAIASKDDFQH--ELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKL 344

Query: 183 LDGQAGA-IREIPRAITGKTNGPSEVAVRQELSRKLVHGQQQGRNFIEFLWRPWWRNNCQ 359
           L  +    I+  P  I    + P +VAV +     +++  +     IEF + PW   +C+
Sbjct: 345 LANELEPYIKSEP--IPESNDAPVKVAVAKNFDDLVINNGKD--TLIEF-YAPWC-GHCK 398

Query: 360 KLGSRSGKSLVKS*KMEEVEHSFKIRCKLANGTGPKFTISNVFRAF-PPTNLSGKALKGN 536
           KL S   + L +  K+++ + +       AN   P+F +      F  P +   K +  N
Sbjct: 399 KL-SPIYEELAE--KLQDEDVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYN 455

Query: 537 SFPKKNPFRDY 569
              + + F  Y
Sbjct: 456 GGREVDDFLKY 466


>AY060296-1|AAL25335.1|  364|Drosophila melanogaster GH13982p
           protein.
          Length = 364

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 27/76 (35%), Positives = 37/76 (48%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADGKQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP* 228
           LNE+G DF  GDKPVV  RD    +   +   S   +    ++  +  +LEP++K   P 
Sbjct: 177 LNEYGYDFV-GDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLA-NELEPYIKSE-PI 233

Query: 229 PGKRTGPVK*PFGKNF 276
           P     PVK    KNF
Sbjct: 234 PESNDAPVKVAVAKNF 249



 Score = 32.3 bits (70), Expect = 1.0
 Identities = 44/191 (23%), Positives = 76/191 (39%), Gaps = 2/191 (1%)
 Frame = +3

Query: 3   EATFAVSDKDDFTHAAQXXXXXXXXXXXXXXXXXXXXXQTNSS*DAEFSIENLLTFTKDL 182
           +  FA++ KDDF H  +                         +   EFS+ENL  F + L
Sbjct: 162 QINFAIASKDDFQH--ELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKL 219

Query: 183 LDGQAGA-IREIPRAITGKTNGPSEVAVRQELSRKLVHGQQQGRNFIEFLWRPWWRNNCQ 359
           L  +    I+  P  I    + P +VAV +     +++  +     IEF + PW   +C+
Sbjct: 220 LANELEPYIKSEP--IPESNDAPVKVAVAKNFDDLVINNGKD--TLIEF-YAPWC-GHCK 273

Query: 360 KLGSRSGKSLVKS*KMEEVEHSFKIRCKLANGTGPKFTISNVFRAF-PPTNLSGKALKGN 536
           KL S   + L +  K+++ + +       AN   P+F +      F  P +   K +  N
Sbjct: 274 KL-SPIYEELAE--KLQDEDVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYN 330

Query: 537 SFPKKNPFRDY 569
              + + F  Y
Sbjct: 331 GGREVDDFLKY 341


>AE013599-1356|AAM68697.1|  364|Drosophila melanogaster CG8983-PB,
           isoform B protein.
          Length = 364

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 27/76 (35%), Positives = 37/76 (48%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADGKQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP* 228
           LNE+G DF  GDKPVV  RD    +   +   S   +    ++  +  +LEP++K   P 
Sbjct: 177 LNEYGYDFV-GDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLA-NELEPYIKSE-PI 233

Query: 229 PGKRTGPVK*PFGKNF 276
           P     PVK    KNF
Sbjct: 234 PESNDAPVKVAVAKNF 249



 Score = 32.3 bits (70), Expect = 1.0
 Identities = 44/191 (23%), Positives = 76/191 (39%), Gaps = 2/191 (1%)
 Frame = +3

Query: 3   EATFAVSDKDDFTHAAQXXXXXXXXXXXXXXXXXXXXXQTNSS*DAEFSIENLLTFTKDL 182
           +  FA++ KDDF H  +                         +   EFS+ENL  F + L
Sbjct: 162 QINFAIASKDDFQH--ELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKL 219

Query: 183 LDGQAGA-IREIPRAITGKTNGPSEVAVRQELSRKLVHGQQQGRNFIEFLWRPWWRNNCQ 359
           L  +    I+  P  I    + P +VAV +     +++  +     IEF + PW   +C+
Sbjct: 220 LANELEPYIKSEP--IPESNDAPVKVAVAKNFDDLVINNGKD--TLIEF-YAPWC-GHCK 273

Query: 360 KLGSRSGKSLVKS*KMEEVEHSFKIRCKLANGTGPKFTISNVFRAF-PPTNLSGKALKGN 536
           KL S   + L +  K+++ + +       AN   P+F +      F  P +   K +  N
Sbjct: 274 KL-SPIYEELAE--KLQDEDVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYN 330

Query: 537 SFPKKNPFRDY 569
              + + F  Y
Sbjct: 331 GGREVDDFLKY 341


>AE013599-1355|AAF58609.2|  489|Drosophila melanogaster CG8983-PA,
           isoform A protein.
          Length = 489

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 27/76 (35%), Positives = 37/76 (48%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADGKQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP* 228
           LNE+G DF  GDKPVV  RD    +   +   S   +    ++  +  +LEP++K   P 
Sbjct: 302 LNEYGYDFV-GDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLA-NELEPYIKSE-PI 358

Query: 229 PGKRTGPVK*PFGKNF 276
           P     PVK    KNF
Sbjct: 359 PESNDAPVKVAVAKNF 374



 Score = 32.3 bits (70), Expect = 1.0
 Identities = 44/191 (23%), Positives = 76/191 (39%), Gaps = 2/191 (1%)
 Frame = +3

Query: 3   EATFAVSDKDDFTHAAQXXXXXXXXXXXXXXXXXXXXXQTNSS*DAEFSIENLLTFTKDL 182
           +  FA++ KDDF H  +                         +   EFS+ENL  F + L
Sbjct: 287 QINFAIASKDDFQH--ELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKL 344

Query: 183 LDGQAGA-IREIPRAITGKTNGPSEVAVRQELSRKLVHGQQQGRNFIEFLWRPWWRNNCQ 359
           L  +    I+  P  I    + P +VAV +     +++  +     IEF + PW   +C+
Sbjct: 345 LANELEPYIKSEP--IPESNDAPVKVAVAKNFDDLVINNGKD--TLIEF-YAPWC-GHCK 398

Query: 360 KLGSRSGKSLVKS*KMEEVEHSFKIRCKLANGTGPKFTISNVFRAF-PPTNLSGKALKGN 536
           KL S   + L +  K+++ + +       AN   P+F +      F  P +   K +  N
Sbjct: 399 KL-SPIYEELAE--KLQDEDVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYN 455

Query: 537 SFPKKNPFRDY 569
              + + F  Y
Sbjct: 456 GGREVDDFLKY 466


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,125,553
Number of Sequences: 53049
Number of extensions: 862305
Number of successful extensions: 1998
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1874
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1992
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4935487923
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).