SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY060438-1|AAL25477.1|  906|Drosophila melanogaster LD46618p pro...    46   6e-05
X51967-1|CAA36225.1| 1057|Drosophila melanogaster protein ( Dros...    41   0.002
AY180919-1|AAN87272.1|  884|Drosophila melanogaster ORF1 protein.      39   0.010
AF456125-1|AAL57609.1|  832|Drosophila melanogaster reverse tran...    39   0.010
AF237761-2|AAF81411.1|  908|Drosophila melanogaster unknown prot...    31   1.5  
AJ278684-2|CAB99192.1|  989|Drosophila melanogaster endonuclease...    31   1.9  
DQ465527-1|ABF00987.1| 2501|Drosophila melanogaster mushroom bod...    29   7.8  
AF209068-1|AAF89163.2| 1871|Drosophila melanogaster Mud protein ...    29   7.8  
AF174134-3|AAF88146.1| 2501|Drosophila melanogaster Mud protein ...    29   7.8  
AE014298-2023|AAN09584.1| 1871|Drosophila melanogaster CG12047-P...    29   7.8  
AE014298-2022|AAF48362.2| 2328|Drosophila melanogaster CG12047-P...    29   7.8  
AE014298-2021|AAN09583.2| 2520|Drosophila melanogaster CG12047-P...    29   7.8  
AE014134-886|AAZ66447.1| 7744|Drosophila melanogaster CG33715-PB...    29   7.8  
AE014134-885|AAZ66446.1| 11707|Drosophila melanogaster CG33715-P...    29   7.8  

>AY060438-1|AAL25477.1|  906|Drosophila melanogaster LD46618p protein.
          Length = 906

 Score = 46.0 bits (104), Expect = 6e-05
 Identities = 39/161 (24%), Positives = 73/161 (45%), Gaps = 12/161 (7%)
 Frame = -3

Query: 465  YADDIVLM------TPTLDQMQAKLEDLRISAEKRGLRINTNKTVD----MRVMSKNTTP 316
            YADDI L+            +Q  L  L    ++  L++N  KT++    ++ +S  T P
Sbjct: 678  YADDIALLYSSNCCNEAARGLQEYLTTLAAWCKRWILKVNPQKTINPCFTLKTLSPVTAP 737

Query: 315  LKLQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWE-SSVMTRRIK 139
            ++L+    +  ++    G  L  +      ++   R+      QL+ +    S MT R K
Sbjct: 738  IELEGVILDQPSQAKYLGITLDKRLTFGPHLKATTRRCYQRMQQLRWLLNRKSTMTLRAK 797

Query: 138  LTLFDSIVKSVLLFGCETWRV-TKTLTNRLQVFVNKCLRSI 19
              ++   V  + L+G + W +  K+  NR+QV  N+ +R+I
Sbjct: 798  RAVYVHCVAPIWLYGIQIWGIAAKSNYNRIQVLQNRAMRAI 838


>X51967-1|CAA36225.1| 1057|Drosophila melanogaster protein (
           Drosophila melanogasterDNA for type II retrotransposable
           element  R2Dm.  ).
          Length = 1057

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 23/76 (30%), Positives = 37/76 (48%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L+  G P   +  +Q  Y G    +  D           GVKQG  LSP+LF +++D ++
Sbjct: 499 LRAYGAPKGFVDYVQNTYEGGGTSLNGDGWSSEEFVPARGVKQGDPLSPILFNLVMDRLL 558

Query: 527 REVVTTLGALNGAKIS 480
           R + + +GA  G  I+
Sbjct: 559 RTLPSEIGAKVGNAIT 574


>AY180919-1|AAN87272.1|  884|Drosophila melanogaster ORF1 protein.
          Length = 884

 Score = 38.7 bits (86), Expect = 0.010
 Identities = 36/147 (24%), Positives = 64/147 (43%), Gaps = 9/147 (6%)
 Frame = -3

Query: 423  MQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTP-------LKLQDCGFEVSTEVYIS 265
            MQ+ L +L I  +K  ++IN NKT +    +K   P       L++ D   +    +   
Sbjct: 715  MQSYLNELDIYYKKWKIKINPNKT-NAIFFTKRRKPRYLPDRQLRILDSPIQWVDNIRYL 773

Query: 264  GELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
            G +   +      I   I K       L P +   S ++   K+ +F +I   +L++G  
Sbjct: 774  GIIFDKKLTFKYHINNTIMKVNKIICTLYPLINRKSKLSISNKIIIFKTIFNPILMYGSP 833

Query: 87   TW-RVTKTLTNRLQVFVNKCLRSILRI 10
             W R  +T   +LQ+  NK L+ I+ +
Sbjct: 834  VWGRCAQTHIKKLQICQNKLLKLIMNL 860


>AF456125-1|AAL57609.1|  832|Drosophila melanogaster reverse
            transcriptase protein.
          Length = 832

 Score = 38.7 bits (86), Expect = 0.010
 Identities = 36/147 (24%), Positives = 64/147 (43%), Gaps = 9/147 (6%)
 Frame = -3

Query: 423  MQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTP-------LKLQDCGFEVSTEVYIS 265
            MQ+ L +L I  +K  ++IN NKT +    +K   P       L++ D   +    +   
Sbjct: 663  MQSYLNELDIYYKKWKIKINPNKT-NAIFFTKRRKPRYLPDRQLRILDSPIQWVDNIRYL 721

Query: 264  GELLSNQGGSDEDIEIRIRKARGAFAQLKP-VWESSVMTRRIKLTLFDSIVKSVLLFGCE 88
            G +   +      I   I K       L P +   S ++   K+ +F +I   +L++G  
Sbjct: 722  GIIFDKKLTFKYHINNTIMKVNKIICTLYPLINRKSKLSISNKIIIFKTIFNPILMYGSP 781

Query: 87   TW-RVTKTLTNRLQVFVNKCLRSILRI 10
             W R  +T   +LQ+  NK L+ I+ +
Sbjct: 782  VWGRCAQTHIKKLQICQNKLLKLIMNL 808


>AF237761-2|AAF81411.1|  908|Drosophila melanogaster unknown
           protein.
          Length = 908

 Score = 31.5 bits (68), Expect = 1.5
 Identities = 16/63 (25%), Positives = 29/63 (46%)
 Frame = -1

Query: 692 IPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREVVT 513
           +P    G++++   G    V     +     + AGV QG +L PLL+ +   D+ +  V+
Sbjct: 605 LPAPYFGLLKSYLEGRRFAVRFHSAISTEHNVAAGVPQGSVLGPLLYCLYSHDMPQPDVS 664

Query: 512 TLG 504
             G
Sbjct: 665 LYG 667


>AJ278684-2|CAB99192.1|  989|Drosophila melanogaster
           endonuclease/reverse transcriptase protein.
          Length = 989

 Score = 31.1 bits (67), Expect = 1.9
 Identities = 17/60 (28%), Positives = 34/60 (56%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           ++  G+P+ I G+I   +R      V +    +  +++AGV QG +L P+L+ ++ D I+
Sbjct: 574 MRNLGVPDYIRGVIGNYFRDRVLWYVTEDGPRSH-QVSAGVPQGSVLGPILWNIMYDGIL 632


>DQ465527-1|ABF00987.1| 2501|Drosophila melanogaster mushroom body
            defect protein protein.
          Length = 2501

 Score = 29.1 bits (62), Expect = 7.8
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = -3

Query: 468  DYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            D  ++ VLM+  L+++QAKL++ +   + + L ++ N+     V S      KL D
Sbjct: 1115 DALENCVLMSTKLEELQAKLQEGQQLVDSQKLELDMNRKELALVKSAYEAQTKLSD 1170


>AF209068-1|AAF89163.2| 1871|Drosophila melanogaster Mud protein
            protein.
          Length = 1871

 Score = 29.1 bits (62), Expect = 7.8
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = -3

Query: 468  DYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            D  ++ VLM+  L+++QAKL++ +   + + L ++ N+     V S      KL D
Sbjct: 1115 DALENCVLMSTKLEELQAKLQEGQQLVDSQKLELDMNRKELALVKSAYEAQTKLSD 1170


>AF174134-3|AAF88146.1| 2501|Drosophila melanogaster Mud protein
            protein.
          Length = 2501

 Score = 29.1 bits (62), Expect = 7.8
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = -3

Query: 468  DYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            D  ++ VLM+  L+++QAKL++ +   + + L ++ N+     V S      KL D
Sbjct: 1115 DALENCVLMSTKLEELQAKLQEGQQLVDSQKLELDMNRKELALVKSAYEAQTKLSD 1170


>AE014298-2023|AAN09584.1| 1871|Drosophila melanogaster CG12047-PC,
            isoform C protein.
          Length = 1871

 Score = 29.1 bits (62), Expect = 7.8
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = -3

Query: 468  DYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            D  ++ VLM+  L+++QAKL++ +   + + L ++ N+     V S      KL D
Sbjct: 1115 DALENCVLMSTKLEELQAKLQEGQQLVDSQKLELDMNRKELALVKSAYEAQTKLSD 1170


>AE014298-2022|AAF48362.2| 2328|Drosophila melanogaster CG12047-PA,
            isoform A protein.
          Length = 2328

 Score = 29.1 bits (62), Expect = 7.8
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = -3

Query: 468  DYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            D  ++ VLM+  L+++QAKL++ +   + + L ++ N+     V S      KL D
Sbjct: 1115 DALENCVLMSTKLEELQAKLQEGQQLVDSQKLELDMNRKELALVKSAYEAQTKLSD 1170


>AE014298-2021|AAN09583.2| 2520|Drosophila melanogaster CG12047-PB,
            isoform B protein.
          Length = 2520

 Score = 29.1 bits (62), Expect = 7.8
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = -3

Query: 468  DYADDIVLMTPTLDQMQAKLEDLRISAEKRGLRINTNKTVDMRVMSKNTTPLKLQD 301
            D  ++ VLM+  L+++QAKL++ +   + + L ++ N+     V S      KL D
Sbjct: 1115 DALENCVLMSTKLEELQAKLQEGQQLVDSQKLELDMNRKELALVKSAYEAQTKLSD 1170


>AE014134-886|AAZ66447.1| 7744|Drosophila melanogaster CG33715-PB,
            isoform B protein.
          Length = 7744

 Score = 29.1 bits (62), Expect = 7.8
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 495  WSENILEDLDYADDIVLMTP-TLDQMQAKLEDLRISAEKRGLRI 367
            W   I E LDY  D+  M+P  LD+  A ++D+ +  ++   R+
Sbjct: 4299 WINEIKEKLDYCSDMSSMSPKELDKKLATIQDVILLKDEGSARV 4342


>AE014134-885|AAZ66446.1| 11707|Drosophila melanogaster CG33715-PD,
            isoform D protein.
          Length = 11707

 Score = 29.1 bits (62), Expect = 7.8
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 495  WSENILEDLDYADDIVLMTP-TLDQMQAKLEDLRISAEKRGLRI 367
            W   I E LDY  D+  M+P  LD+  A ++D+ +  ++   R+
Sbjct: 4299 WINEIKEKLDYCSDMSSMSPKELDKKLATIQDVILLKDEGSARV 4342


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 39,785,522
Number of Sequences: 53049
Number of extensions: 895736
Number of successful extensions: 2126
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 2009
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2126
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3962724636
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).