SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0036
         (648 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M20419-1|AAA28989.1|  447|Drosophila melanogaster protein ( D.me...   184   1e-46
BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p pro...   184   1e-46
AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA...   184   1e-46
AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB...   184   1e-46
M20420-1|AAA28991.1|  446|Drosophila melanogaster protein ( D.me...   177   8e-45
AY118725-1|AAM50585.1|  446|Drosophila melanogaster GH02051p pro...   177   8e-45
AE014297-930|AAF54373.1|  446|Drosophila melanogaster CG9359-PA ...   177   8e-45
AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p pro...   168   6e-42
AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA...   168   6e-42
X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubul...   163   1e-40
M22335-1|AAA28993.1|  454|Drosophila melanogaster protein ( D.me...   163   1e-40
BT015991-1|AAV36876.1|  454|Drosophila melanogaster RE53159p pro...   163   1e-40
AE013599-3851|AAF47193.2|  454|Drosophila melanogaster CG3401-PA...   163   1e-40
AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD...   128   8e-30
AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC...   128   8e-30
M14645-1|AAA28987.1|  450|Drosophila melanogaster protein ( D.me...    97   1e-20
M14643-1|AAA28985.1|  450|Drosophila melanogaster protein ( D.me...    97   1e-20
BT016118-1|AAV37003.1|  450|Drosophila melanogaster LD07757p pro...    97   1e-20
BT012506-1|AAS93777.1|  450|Drosophila melanogaster AT25469p pro...    97   1e-20
BT003630-1|AAO39634.1|  450|Drosophila melanogaster AT26363p pro...    97   1e-20
AY084208-1|AAL89946.1|  450|Drosophila melanogaster SD07763p pro...    97   1e-20
AE014297-627|AAN13341.1|  450|Drosophila melanogaster CG2512-PB,...    97   1e-20
AE014297-626|AAF54007.1|  450|Drosophila melanogaster CG2512-PA,...    97   1e-20
AE014297-554|AAF54067.1|  450|Drosophila melanogaster CG1913-PA ...    97   1e-20
M14644-1|AAA28986.1|  449|Drosophila melanogaster protein ( D.me...    95   6e-20
AY113631-1|AAM29636.1|  449|Drosophila melanogaster RH71862p pro...    95   6e-20
AE014297-1015|AAF54433.1|  449|Drosophila melanogaster CG9476-PA...    95   6e-20
BT011034-1|AAR30194.1|  240|Drosophila melanogaster RE44641p pro...    83   3e-16
M14646-1|AAA28988.1|  462|Drosophila melanogaster protein ( D.me...    80   3e-15
AE014296-1707|AAF50226.2|  462|Drosophila melanogaster CG8308-PA...    80   3e-15
AY089468-1|AAL90206.1|  462|Drosophila melanogaster AT27896p pro...    79   4e-15
AE014296-1121|AAF50659.1|  462|Drosophila melanogaster CG32396-P...    79   4e-15
M61765-1|AAA28597.1|  475|Drosophila melanogaster gamma-tubulin ...    75   6e-14
AY069633-1|AAL39778.1|  475|Drosophila melanogaster LD40196p pro...    75   6e-14
AF073994-1|AAC27620.1|  333|Drosophila melanogaster gamma-tubuli...    75   6e-14
AE014134-523|AAF51174.1|  475|Drosophila melanogaster CG3157-PA ...    75   6e-14
M76765-1|AAB52553.1|  457|Drosophila melanogaster gamma-tubulin ...    74   2e-13
AY070558-1|AAL48029.1|  457|Drosophila melanogaster LD32755p pro...    74   2e-13
AJ010552-1|CAA09233.1|  457|Drosophila melanogaster gamma-tubuli...    74   2e-13
AF091265-1|AAC64117.1|  457|Drosophila melanogaster gamma-tubuli...    74   2e-13
AF081253-1|AAC35844.1|  351|Drosophila melanogaster gamma-tubuli...    74   2e-13
AF081252-1|AAC35843.1|  457|Drosophila melanogaster gamma-tubuli...    74   2e-13
AE014134-3061|AAF53774.1|  457|Drosophila melanogaster CG17566-P...    74   2e-13
AY089253-1|AAL89991.1|  455|Drosophila melanogaster AT04270p pro...    65   7e-11
AE014297-2432|AAF55488.1|  455|Drosophila melanogaster CG7794-PA...    65   7e-11
S60740-1|AAD13917.1|   25|Drosophila melanogaster beta 3 tubulin...    48   8e-06
X16825-1|CAA34725.1|   19|Drosophila melanogaster protein ( Dros...    44   2e-04
AY095530-1|AAM12261.1| 1079|Drosophila melanogaster RE37107p pro...    30   3.1  
AE014296-2770|AAF49437.2| 1079|Drosophila melanogaster CG32164-P...    30   3.1  
AE014296-2768|AAG22314.2| 1080|Drosophila melanogaster CG32165-P...    30   3.1  
AY061430-1|AAL28978.1|  474|Drosophila melanogaster LD35981p pro...    29   4.1  
AE014298-2767|AAF48885.2|  474|Drosophila melanogaster CG6961-PA...    29   4.1  
AE014298-2765|AAF48882.2|  474|Drosophila melanogaster CG18259-P...    29   4.1  
BT003322-1|AAO25082.1|  575|Drosophila melanogaster AT02511p pro...    28   9.5  
AY119214-1|AAM51074.1|  321|Drosophila melanogaster SD15982p pro...    28   9.5  
AY071124-1|AAL48746.1|  420|Drosophila melanogaster RE17165p pro...    28   9.5  
AE014297-1414|AAF54725.1|  321|Drosophila melanogaster CG18347-P...    28   9.5  
AE014296-850|AAF47902.2|  420|Drosophila melanogaster CG15021-PA...    28   9.5  
AE013599-3720|AAM68275.2|  489|Drosophila melanogaster CG11184-P...    28   9.5  
AE013599-2343|AAS64829.1|  575|Drosophila melanogaster CG15920-P...    28   9.5  
AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-P...    28   9.5  

>M20419-1|AAA28989.1|  447|Drosophila melanogaster protein (
           D.melanogaster beta-1 tubulin mRNA, complete cds. ).
          Length = 447

 Score =  184 bits (447), Expect = 1e-46
 Identities = 83/88 (94%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWE+ISDEHGIDATG Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGTYHGDSDLQL 44



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 22/44 (50%), Positives = 23/44 (52%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR MNT+SVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRSMNTYSVVPSPK 174


>BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p
           protein.
          Length = 447

 Score =  184 bits (447), Expect = 1e-46
 Identities = 83/88 (94%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 42/44 (95%), Positives = 43/44 (97%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWE+ISDEHGIDATGAY GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDLQL 44



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNT+SVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK 174


>AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA,
           isoform A protein.
          Length = 456

 Score =  184 bits (447), Expect = 1e-46
 Identities = 83/88 (94%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 55  RINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 114

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 115 YTEGAELVDSVLDVVRKEAESCDCLQGF 142



 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 23/25 (92%), Positives = 24/25 (96%)
 Frame = +3

Query: 180 FWEVISDEHGIDATGAYSGDSDLQL 254
           FWE+ISDEHGIDATGAY GDSDLQL
Sbjct: 29  FWEIISDEHGIDATGAYHGDSDLQL 53



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNT+SVVPS K
Sbjct: 140 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK 183


>AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB,
           isoform B protein.
          Length = 447

 Score =  184 bits (447), Expect = 1e-46
 Identities = 83/88 (94%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 42/44 (95%), Positives = 43/44 (97%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWE+ISDEHGIDATGAY GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDLQL 44



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNT+SVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK 174


>M20420-1|AAA28991.1|  446|Drosophila melanogaster protein (
           D.melanogaster beta-2 tubulin mRNA, complete cds. ).
          Length = 446

 Score =  177 bits (432), Expect = 8e-45
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSG FGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+EGCDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESEGCDCLQGF 133



 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 40/44 (90%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIG KFWEVISDEH IDATG Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQL 44



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 26/53 (49%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 122 KESEGCDCLQGFQSTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AY118725-1|AAM50585.1|  446|Drosophila melanogaster GH02051p
           protein.
          Length = 446

 Score =  177 bits (432), Expect = 8e-45
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSG FGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+EGCDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESEGCDCLQGF 133



 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 40/44 (90%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIG KFWEVISDEH IDATG Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQL 44



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 26/53 (49%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 122 KESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AE014297-930|AAF54373.1|  446|Drosophila melanogaster CG9359-PA
           protein.
          Length = 446

 Score =  177 bits (432), Expect = 8e-45
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSG FGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+EGCDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESEGCDCLQGF 133



 Score = 89.0 bits (211), Expect = 5e-18
 Identities = 40/44 (90%), Positives = 40/44 (90%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIG KFWEVISDEH IDATG Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQL 44



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 26/53 (49%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 122 KESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p
           protein.
          Length = 457

 Score =  168 bits (408), Expect = 6e-42
 Identities = 72/88 (81%), Positives = 82/88 (93%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEAS GKYVPRAV++DLEPGTMDSVR  P GQ+FRPDNFV+GQSGAGNNWAKGH
Sbjct: 46  RIDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVL+V+RKE+EGCDC + F
Sbjct: 106 YTEGAELIDSVLEVLRKESEGCDCLQGF 133



 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 34/43 (79%), Positives = 38/43 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQ 251
           MREIVH+QAGQCGNQIG+KFWE+ISDEHGID  G Y G+S LQ
Sbjct: 1   MREIVHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESALQ 43



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMN+FSVVPS K
Sbjct: 122 KESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDRIMNSFSVVPSPK 174


>AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA
           protein.
          Length = 522

 Score =  168 bits (408), Expect = 6e-42
 Identities = 72/88 (81%), Positives = 82/88 (93%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEAS GKYVPRAV++DLEPGTMDSVR  P GQ+FRPDNFV+GQSGAGNNWAKGH
Sbjct: 46  RIDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+DSVL+V+RKE+EGCDC + F
Sbjct: 106 YTEGAELIDSVLEVLRKESEGCDCLQGF 133



 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 34/43 (79%), Positives = 38/43 (88%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQ 251
           MREIVH+QAGQCGNQIG+KFWE+ISDEHGID  G Y G+S LQ
Sbjct: 1   MREIVHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESALQ 43



 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMN+FSVVPS K
Sbjct: 122 KESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDRIMNSFSVVPSPK 174


>X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubulin
           protein.
          Length = 435

 Score =  163 bits (397), Expect = 1e-40
 Identities = 73/94 (77%), Positives = 84/94 (89%), Gaps = 6/94 (6%)
 Frame = +2

Query: 257 RINVYYNEAS------GGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGN 418
           R++VYYNEAS      GGKYVPRA+++DLEPGTM+SVRSGP+GQ+FRPDNFV+GQSGAGN
Sbjct: 27  RVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGN 86

Query: 419 NWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           NWAKGHYTEGAELVD+VLDVVRKE E CDC + F
Sbjct: 87  NWAKGHYTEGAELVDNVLDVVRKECENCDCLQGF 120



 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +3

Query: 180 FWEVISDEHGIDATGAYSGDSDLQL 254
           FWE+IS+EHGID+ G Y GDSDLQL
Sbjct: 1   FWEIISEEHGIDSNGIYVGDSDLQL 25



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNT+SVVPS K
Sbjct: 118 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK 161


>M22335-1|AAA28993.1|  454|Drosophila melanogaster protein (
           D.melanogaster beta-3 tubulin gene, exons 2, 3 and 4. ).
          Length = 454

 Score =  163 bits (397), Expect = 1e-40
 Identities = 73/94 (77%), Positives = 84/94 (89%), Gaps = 6/94 (6%)
 Frame = +2

Query: 257 RINVYYNEAS------GGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGN 418
           R++VYYNEAS      GGKYVPRA+++DLEPGTM+SVRSGP+GQ+FRPDNFV+GQSGAGN
Sbjct: 46  RVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGN 105

Query: 419 NWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           NWAKGHYTEGAELVD+VLDVVRKE E CDC + F
Sbjct: 106 NWAKGHYTEGAELVDNVLDVVRKECENCDCLQGF 139



 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 37/44 (84%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWE+IS+EHGID+ G Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQL 44



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNT+SVVPS K
Sbjct: 137 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK 180


>BT015991-1|AAV36876.1|  454|Drosophila melanogaster RE53159p
           protein.
          Length = 454

 Score =  163 bits (397), Expect = 1e-40
 Identities = 73/94 (77%), Positives = 84/94 (89%), Gaps = 6/94 (6%)
 Frame = +2

Query: 257 RINVYYNEAS------GGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGN 418
           R++VYYNEAS      GGKYVPRA+++DLEPGTM+SVRSGP+GQ+FRPDNFV+GQSGAGN
Sbjct: 46  RVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGN 105

Query: 419 NWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           NWAKGHYTEGAELVD+VLDVVRKE E CDC + F
Sbjct: 106 NWAKGHYTEGAELVDNVLDVVRKECENCDCLQGF 139



 Score = 85.0 bits (201), Expect = 8e-17
 Identities = 36/44 (81%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIV++QAGQCGNQIGAKFWE+IS+EHGID+ G Y GDSDLQL
Sbjct: 1   MREIVNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQL 44



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNT+SVVPS K
Sbjct: 137 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK 180


>AE013599-3851|AAF47193.2|  454|Drosophila melanogaster CG3401-PA
           protein.
          Length = 454

 Score =  163 bits (397), Expect = 1e-40
 Identities = 73/94 (77%), Positives = 84/94 (89%), Gaps = 6/94 (6%)
 Frame = +2

Query: 257 RINVYYNEAS------GGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGN 418
           R++VYYNEAS      GGKYVPRA+++DLEPGTM+SVRSGP+GQ+FRPDNFV+GQSGAGN
Sbjct: 46  RVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGN 105

Query: 419 NWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           NWAKGHYTEGAELVD+VLDVVRKE E CDC + F
Sbjct: 106 NWAKGHYTEGAELVDNVLDVVRKECENCDCLQGF 139



 Score = 85.0 bits (201), Expect = 8e-17
 Identities = 36/44 (81%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIV++QAGQCGNQIGAKFWE+IS+EHGID+ G Y GDSDLQL
Sbjct: 1   MREIVNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQL 44



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNT+SVVPS K
Sbjct: 137 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK 180


>AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD,
           isoform D protein.
          Length = 375

 Score =  128 bits (308), Expect = 8e-30
 Identities = 57/61 (93%), Positives = 58/61 (95%)
 Frame = +2

Query: 338 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRV 517
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDC + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 518 F 520
           F
Sbjct: 61  F 61



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNT+SVVPS K
Sbjct: 59  QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK 102


>AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC,
           isoform C protein.
          Length = 375

 Score =  128 bits (308), Expect = 8e-30
 Identities = 57/61 (93%), Positives = 58/61 (95%)
 Frame = +2

Query: 338 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRV 517
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDC + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 518 F 520
           F
Sbjct: 61  F 61



 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNT+SVVPS K
Sbjct: 59  QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK 102


>M14645-1|AAA28987.1|  450|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-3), complete
           cds. ).
          Length = 450

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADQC 129



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>M14643-1|AAA28985.1|  450|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-1), complete
           cds. ).
          Length = 450

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADQC 129



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>BT016118-1|AAV37003.1|  450|Drosophila melanogaster LD07757p
           protein.
          Length = 450

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADQC 129



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>BT012506-1|AAS93777.1|  450|Drosophila melanogaster AT25469p
           protein.
          Length = 450

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADQC 129



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>BT003630-1|AAO39634.1|  450|Drosophila melanogaster AT26363p
           protein.
          Length = 450

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADQC 129



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>AY084208-1|AAL89946.1|  450|Drosophila melanogaster SD07763p
           protein.
          Length = 450

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADQC 129



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>AE014297-627|AAN13341.1|  450|Drosophila melanogaster CG2512-PB,
           isoform B protein.
          Length = 450

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADQC 129



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>AE014297-626|AAF54007.1|  450|Drosophila melanogaster CG2512-PA,
           isoform A protein.
          Length = 450

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADQC 129



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>AE014297-554|AAF54067.1|  450|Drosophila melanogaster CG1913-PA
           protein.
          Length = 450

 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADQC 129



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>M14644-1|AAA28986.1|  449|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-2), complete
           cds. ).
          Length = 449

 Score = 95.5 bits (227), Expect = 6e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  STFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDVVLDRIRKLADQC 129



 Score = 37.1 bits (82), Expect = 0.021
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + +  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSD 39


>AY113631-1|AAM29636.1|  449|Drosophila melanogaster RH71862p
           protein.
          Length = 449

 Score = 95.5 bits (227), Expect = 6e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  STFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDVVLDRIRKLADQC 129



 Score = 37.1 bits (82), Expect = 0.021
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + +  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSD 39


>AE014297-1015|AAF54433.1|  449|Drosophila melanogaster CG9476-PA
           protein.
          Length = 449

 Score = 95.5 bits (227), Expect = 6e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  STFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDVVLDRIRKLADQC 129



 Score = 37.1 bits (82), Expect = 0.021
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239
           MRE + +  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSD 39


>BT011034-1|AAR30194.1|  240|Drosophila melanogaster RE44641p
           protein.
          Length = 240

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++ E   GK VPR++ VDLEP  +D VR+G  G+++ P+  + G+  A NN+A+G Y+ G
Sbjct: 63  FFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMGELYHPEQLISGKEDAANNYARGRYSIG 122

Query: 449 AELVDSVLDVVRKEAEGCDCCRVF 520
            E++D V   ++K AE CD  + F
Sbjct: 123 KEVIDRVTSRLQKIAEQCDSLQGF 146



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 24/61 (39%), Positives = 35/61 (57%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLNASMSTITKLQGASTS 302
           MRE+V IQ GQCG QIG   WE+   EHGI+  G+     +L  + S +++     A+ +
Sbjct: 1   MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDA 60

Query: 303 R 305
           R
Sbjct: 61  R 61


>M14646-1|AAA28988.1|  462|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-4), complete
           cds. ).
          Length = 462

 Score = 79.8 bits (188), Expect = 3e-15
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++ E   GK VPR++ VDLEP  +D VR+G   +++ P+  + G+  A NN+A+G Y+ G
Sbjct: 63  FFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIG 122

Query: 449 AELVDSVLDVVRKEAEGCDCCRVF 520
            E++D V   ++K AE CD  + F
Sbjct: 123 KEVIDRVTSRLQKIAEQCDSLQGF 146



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 24/61 (39%), Positives = 35/61 (57%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLNASMSTITKLQGASTS 302
           MRE+V IQ GQCG QIG   WE+   EHGI+  G+     +L  + S +++     A+ +
Sbjct: 1   MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDA 60

Query: 303 R 305
           R
Sbjct: 61  R 61


>AE014296-1707|AAF50226.2|  462|Drosophila melanogaster CG8308-PA
           protein.
          Length = 462

 Score = 79.8 bits (188), Expect = 3e-15
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++ E   GK VPR++ VDLEP  +D VR+G   +++ P+  + G+  A NN+A+G Y+ G
Sbjct: 63  FFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIG 122

Query: 449 AELVDSVLDVVRKEAEGCDCCRVF 520
            E++D V   ++K AE CD  + F
Sbjct: 123 KEVIDRVTSRLQKIAEQCDSLQGF 146



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 24/61 (39%), Positives = 35/61 (57%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLNASMSTITKLQGASTS 302
           MRE+V IQ GQCG QIG   WE+   EHGI+  G+     +L  + S +++     A+ +
Sbjct: 1   MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDA 60

Query: 303 R 305
           R
Sbjct: 61  R 61


>AY089468-1|AAL90206.1|  462|Drosophila melanogaster AT27896p
           protein.
          Length = 462

 Score = 79.4 bits (187), Expect = 4e-15
 Identities = 33/88 (37%), Positives = 57/88 (64%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINV++N  +  ++  R +++D E  T+  + +    Q++RP+NFV G   AGNN+A+G+
Sbjct: 47  RINVFFNATASKRFYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSESAGNNFARGY 104

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           +T+GA ++D VL+  R+E E  D  + F
Sbjct: 105 HTDGAAILDQVLENTRREVESVDSLQGF 132



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGID-ATGAYSGDSDLQL 254
           MREIV +Q G  GN IG  FW VIS EHG+D A+G + G S LQL
Sbjct: 1   MREIVTLQIGGAGNAIGDSFWHVISHEHGVDYASGRFGGTSPLQL 45


>AE014296-1121|AAF50659.1|  462|Drosophila melanogaster CG32396-PA
           protein.
          Length = 462

 Score = 79.4 bits (187), Expect = 4e-15
 Identities = 33/88 (37%), Positives = 57/88 (64%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINV++N  +  ++  R +++D E  T+  + +    Q++RP+NFV G   AGNN+A+G+
Sbjct: 47  RINVFFNATASKRFYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSESAGNNFARGY 104

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           +T+GA ++D VL+  R+E E  D  + F
Sbjct: 105 HTDGAAILDQVLENTRREVESVDSLQGF 132



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGID-ATGAYSGDSDLQL 254
           MREIV +Q G  GN IG  FW VIS EHG+D A+G + G S LQL
Sbjct: 1   MREIVTLQIGGAGNAIGDSFWHVISHEHGVDYASGRFGGTSPLQL 45


>M61765-1|AAA28597.1|  475|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 475

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 32/90 (35%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++    + +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G Y++G +L + V D++ +EA+G D    F
Sbjct: 107 G-YSQGEKLQEEVFDIIDREADGSDSLEGF 135



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI  +G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35


>AY069633-1|AAL39778.1|  475|Drosophila melanogaster LD40196p
           protein.
          Length = 475

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 32/90 (35%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++    + +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G Y++G +L + V D++ +EA+G D    F
Sbjct: 107 G-YSQGEKLQEEVFDIIDREADGSDSLEGF 135



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI  +G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35


>AF073994-1|AAC27620.1|  333|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 333

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 32/90 (35%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++    + +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G Y++G +L + V D++ +EA+G D    F
Sbjct: 107 G-YSQGEKLQEEVFDIIDREADGSDSLEGF 135



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI  +G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35


>AE014134-523|AAF51174.1|  475|Drosophila melanogaster CG3157-PA
           protein.
          Length = 475

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 32/90 (35%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++    + +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G Y++G +L + V D++ +EA+G D    F
Sbjct: 107 G-YSQGEKLQEEVFDIIDREADGSDSLEGF 135



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI  +G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35


>M76765-1|AAB52553.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 30/90 (33%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + V D++ +EA+G D    F
Sbjct: 107 G-FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AY070558-1|AAL48029.1|  457|Drosophila melanogaster LD32755p
           protein.
          Length = 457

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 30/90 (33%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + V D++ +EA+G D    F
Sbjct: 107 G-FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AJ010552-1|CAA09233.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 30/90 (33%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + V D++ +EA+G D    F
Sbjct: 107 G-FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AF091265-1|AAC64117.1|  457|Drosophila melanogaster gamma-tubulin
           37CD protein.
          Length = 457

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 30/90 (33%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + V D++ +EA+G D    F
Sbjct: 107 G-FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AF081253-1|AAC35844.1|  351|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 351

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 30/90 (33%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + V D++ +EA+G D    F
Sbjct: 107 G-FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AF081252-1|AAC35843.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 30/90 (33%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + V D++ +EA+G D    F
Sbjct: 107 G-FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AE014134-3061|AAF53774.1|  457|Drosophila melanogaster CG17566-PA
           protein.
          Length = 457

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 30/90 (33%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + V D++ +EA+G D    F
Sbjct: 107 G-FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AY089253-1|AAL89991.1|  455|Drosophila melanogaster AT04270p
           protein.
          Length = 455

 Score = 65.3 bits (152), Expect = 7e-11
 Identities = 26/73 (35%), Positives = 46/73 (63%)
 Frame = +2

Query: 302 PRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV 481
           PR VM+D EP  +D +R+G +  +F PD  + G+  +G+N+A+G+    +EL+D  ++ +
Sbjct: 63  PRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAI 122

Query: 482 RKEAEGCDCCRVF 520
           R+ A+ C   R F
Sbjct: 123 RRVADRCRNLRGF 135



 Score = 33.9 bits (74), Expect = 0.19
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ I  GQ G QI    WE+   EHGI A G
Sbjct: 6   EIIQIHIGQAGVQIANACWELFCLEHGILANG 37


>AE014297-2432|AAF55488.1|  455|Drosophila melanogaster CG7794-PA
           protein.
          Length = 455

 Score = 65.3 bits (152), Expect = 7e-11
 Identities = 26/73 (35%), Positives = 46/73 (63%)
 Frame = +2

Query: 302 PRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV 481
           PR VM+D EP  +D +R+G +  +F PD  + G+  +G+N+A+G+    +EL+D  ++ +
Sbjct: 63  PRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAI 122

Query: 482 RKEAEGCDCCRVF 520
           R+ A+ C   R F
Sbjct: 123 RRVADRCRNLRGF 135



 Score = 33.9 bits (74), Expect = 0.19
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           EI+ I  GQ G QI    WE+   EHGI A G
Sbjct: 6   EIIQIHIGQAGVQIANACWELFCLEHGILANG 37


>S60740-1|AAD13917.1|   25|Drosophila melanogaster beta 3 tubulin
           protein.
          Length = 25

 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +3

Query: 180 FWEVISDEHGIDATGAYSGDSDLQL 254
           FWE+IS+EHGID+ G Y GDSDLQL
Sbjct: 1   FWEIISEEHGIDSNGIYVGDSDLQL 25


>X16825-1|CAA34725.1|   19|Drosophila melanogaster protein (
           Drosophila melanogasterDNA for 60C beta tubulin gene
           making beta 3 tubulin isoform.).
          Length = 19

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/19 (94%), Positives = 19/19 (100%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAK 179
           MREIVH+QAGQCGNQIGAK
Sbjct: 1   MREIVHLQAGQCGNQIGAK 19


>AY095530-1|AAM12261.1| 1079|Drosophila melanogaster RE37107p
           protein.
          Length = 1079

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 14/31 (45%), Positives = 21/31 (67%)
 Frame = -2

Query: 479 LHPVPNQPVQPPLCNVLSPSYSPPQTVRRRS 387
           LH VP++ + PPL ++L P+   P+ V RRS
Sbjct: 344 LHMVPDKFI-PPLLDLLEPALQSPEPVLRRS 373


>AE014296-2770|AAF49437.2| 1079|Drosophila melanogaster CG32164-PA
           protein.
          Length = 1079

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 14/31 (45%), Positives = 21/31 (67%)
 Frame = -2

Query: 479 LHPVPNQPVQPPLCNVLSPSYSPPQTVRRRS 387
           LH VP++ + PPL ++L P+   P+ V RRS
Sbjct: 344 LHMVPDKFI-PPLLDLLEPALQSPEPVLRRS 373


>AE014296-2768|AAG22314.2| 1080|Drosophila melanogaster CG32165-PA
           protein.
          Length = 1080

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 14/31 (45%), Positives = 21/31 (67%)
 Frame = -2

Query: 479 LHPVPNQPVQPPLCNVLSPSYSPPQTVRRRS 387
           LH VP++ + PPL ++L P+   P+ V RRS
Sbjct: 345 LHMVPDKFI-PPLLDLLEPALQSPEPVLRRS 374


>AY061430-1|AAL28978.1|  474|Drosophila melanogaster LD35981p
           protein.
          Length = 474

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 17/29 (58%), Positives = 17/29 (58%)
 Frame = -3

Query: 340 HGSRLKVHHHSSRDVLAP*SFVIVDIDAL 254
           H SR  VH  SSR V    S V VDIDAL
Sbjct: 438 HSSRRSVHKASSRTVTTNSSGVEVDIDAL 466


>AE014298-2767|AAF48885.2|  474|Drosophila melanogaster CG6961-PA
           protein.
          Length = 474

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 17/29 (58%), Positives = 17/29 (58%)
 Frame = -3

Query: 340 HGSRLKVHHHSSRDVLAP*SFVIVDIDAL 254
           H SR  VH  SSR V    S V VDIDAL
Sbjct: 438 HSSRRSVHKASSRTVTTNSSGVEVDIDAL 466


>AE014298-2765|AAF48882.2|  474|Drosophila melanogaster CG18259-PA
           protein.
          Length = 474

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 17/29 (58%), Positives = 17/29 (58%)
 Frame = -3

Query: 340 HGSRLKVHHHSSRDVLAP*SFVIVDIDAL 254
           H SR  VH  SSR V    S V VDIDAL
Sbjct: 438 HSSRRSVHKASSRTVTTNSSGVEVDIDAL 466


>BT003322-1|AAO25082.1|  575|Drosophila melanogaster AT02511p
           protein.
          Length = 575

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +2

Query: 320 DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           D   G+  S   GP GQ    D +  G+ G GN    G Y+ G
Sbjct: 360 DANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGG 402


>AY119214-1|AAM51074.1|  321|Drosophila melanogaster SD15982p
           protein.
          Length = 321

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = -1

Query: 420 LFPAPDCPKTKLSGRKICPNGPERTESMVPGSRSTITARGTY 295
           +FP  D  KT+L  ++I PNG     SM    R T  A G +
Sbjct: 39  VFPL-DLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYF 79


>AY071124-1|AAL48746.1|  420|Drosophila melanogaster RE17165p
           protein.
          Length = 420

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%)
 Frame = -2

Query: 473 PVPNQPVQP-PLCNVLSPSYSPPQTVRRRSCP 381
           P P  P QP P      PSY PPQT   R  P
Sbjct: 125 PPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPP 156


>AE014297-1414|AAF54725.1|  321|Drosophila melanogaster CG18347-PA
           protein.
          Length = 321

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = -1

Query: 420 LFPAPDCPKTKLSGRKICPNGPERTESMVPGSRSTITARGTY 295
           +FP  D  KT+L  ++I PNG     SM    R T  A G +
Sbjct: 39  VFPL-DLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYF 79


>AE014296-850|AAF47902.2|  420|Drosophila melanogaster CG15021-PA
           protein.
          Length = 420

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%)
 Frame = -2

Query: 473 PVPNQPVQP-PLCNVLSPSYSPPQTVRRRSCP 381
           P P  P QP P      PSY PPQT   R  P
Sbjct: 125 PPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPP 156


>AE013599-3720|AAM68275.2|  489|Drosophila melanogaster CG11184-PC,
           isoform C protein.
          Length = 489

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = -2

Query: 425 PSYSP-PQTVRRRSCPVGRFAQTARNGRSPWFQ 330
           P  SP P+ V + SCP  + A+ AR  R PW++
Sbjct: 437 PFTSPKPEFVHQMSCPKVQAAKMARMERLPWWR 469


>AE013599-2343|AAS64829.1|  575|Drosophila melanogaster CG15920-PB,
           isoform B protein.
          Length = 575

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +2

Query: 320 DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           D   G+  S   GP GQ    D +  G+ G GN    G Y+ G
Sbjct: 360 DANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGG 402


>AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-PA,
           isoform A protein.
          Length = 620

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +2

Query: 320 DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           D   G+  S   GP GQ    D +  G+ G GN    G Y+ G
Sbjct: 405 DANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGG 447


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,213,005
Number of Sequences: 53049
Number of extensions: 690015
Number of successful extensions: 2283
Number of sequences better than 10.0: 61
Number of HSP's better than 10.0 without gapping: 2029
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2260
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2744900550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).