SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M20420-1|AAA28991.1|  446|Drosophila melanogaster protein ( D.me...   175   4e-44
AY118725-1|AAM50585.1|  446|Drosophila melanogaster GH02051p pro...   175   4e-44
AE014297-930|AAF54373.1|  446|Drosophila melanogaster CG9359-PA ...   175   4e-44
M22335-1|AAA28993.1|  454|Drosophila melanogaster protein ( D.me...   175   5e-44
M20419-1|AAA28989.1|  447|Drosophila melanogaster protein ( D.me...   175   5e-44
BT015991-1|AAV36876.1|  454|Drosophila melanogaster RE53159p pro...   175   5e-44
BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p pro...   175   5e-44
AE013599-3851|AAF47193.2|  454|Drosophila melanogaster CG3401-PA...   175   5e-44
AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD...   175   5e-44
AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC...   175   5e-44
AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA...   175   5e-44
AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB...   175   5e-44
X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubul...   172   3e-43
AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p pro...   169   3e-42
AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA...   169   3e-42
AY089468-1|AAL90206.1|  462|Drosophila melanogaster AT27896p pro...   130   1e-30
AE014296-1121|AAF50659.1|  462|Drosophila melanogaster CG32396-P...   130   1e-30
M14643-1|AAA28985.1|  450|Drosophila melanogaster protein ( D.me...    91   2e-18
BT012506-1|AAS93777.1|  450|Drosophila melanogaster AT25469p pro...    91   2e-18
AE014297-554|AAF54067.1|  450|Drosophila melanogaster CG1913-PA ...    91   2e-18
M14644-1|AAA28986.1|  449|Drosophila melanogaster protein ( D.me...    89   7e-18
AY113631-1|AAM29636.1|  449|Drosophila melanogaster RH71862p pro...    89   7e-18
AE014297-1015|AAF54433.1|  449|Drosophila melanogaster CG9476-PA...    89   7e-18
M14645-1|AAA28987.1|  450|Drosophila melanogaster protein ( D.me...    87   3e-17
BT016118-1|AAV37003.1|  450|Drosophila melanogaster LD07757p pro...    87   3e-17
BT003630-1|AAO39634.1|  450|Drosophila melanogaster AT26363p pro...    87   3e-17
AY084208-1|AAL89946.1|  450|Drosophila melanogaster SD07763p pro...    87   3e-17
AE014297-627|AAN13341.1|  450|Drosophila melanogaster CG2512-PB,...    87   3e-17
AE014297-626|AAF54007.1|  450|Drosophila melanogaster CG2512-PA,...    87   3e-17
M14646-1|AAA28988.1|  462|Drosophila melanogaster protein ( D.me...    83   3e-16
AE014296-1707|AAF50226.2|  462|Drosophila melanogaster CG8308-PA...    83   3e-16
AY089253-1|AAL89991.1|  455|Drosophila melanogaster AT04270p pro...    71   2e-12
AE014297-2432|AAF55488.1|  455|Drosophila melanogaster CG7794-PA...    71   2e-12
M61765-1|AAA28597.1|  475|Drosophila melanogaster gamma-tubulin ...    57   2e-08
AY069633-1|AAL39778.1|  475|Drosophila melanogaster LD40196p pro...    57   2e-08
AF073994-1|AAC27620.1|  333|Drosophila melanogaster gamma-tubuli...    57   2e-08
AE014134-523|AAF51174.1|  475|Drosophila melanogaster CG3157-PA ...    57   2e-08
M76765-1|AAB52553.1|  457|Drosophila melanogaster gamma-tubulin ...    53   4e-07
AY070558-1|AAL48029.1|  457|Drosophila melanogaster LD32755p pro...    52   8e-07
AJ010552-1|CAA09233.1|  457|Drosophila melanogaster gamma-tubuli...    52   8e-07
AF091265-1|AAC64117.1|  457|Drosophila melanogaster gamma-tubuli...    52   8e-07
AF081253-1|AAC35844.1|  351|Drosophila melanogaster gamma-tubuli...    52   8e-07
AF081252-1|AAC35843.1|  457|Drosophila melanogaster gamma-tubuli...    52   8e-07
AE014134-3061|AAF53774.1|  457|Drosophila melanogaster CG17566-P...    52   8e-07
AY327466-1|AAQ16306.1|  381|Drosophila melanogaster peptidoglyca...    31   1.5  
AE014296-1609|AAS65052.1|  511|Drosophila melanogaster CG4432-PC...    31   2.0  
AY089407-1|AAL90145.1|  440|Drosophila melanogaster AT23003p pro...    30   3.5  
AE014297-812|AAF54285.2|  440|Drosophila melanogaster CG8236-PA ...    30   3.5  

>M20420-1|AAA28991.1|  446|Drosophila melanogaster protein (
           D.melanogaster beta-2 tubulin mRNA, complete cds. ).
          Length = 446

 Score =  175 bits (427), Expect = 4e-44
 Identities = 82/113 (72%), Positives = 89/113 (78%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARILSSGYP 340
           FDAKNMM ACDPRHGRYLTVA IFRG    K++       + K +       P
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIP 346



 Score =  167 bits (406), Expect = 1e-41
 Identities = 73/85 (85%), Positives = 81/85 (95%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS++FVEWIPNNCK AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKRVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AY118725-1|AAM50585.1|  446|Drosophila melanogaster GH02051p
           protein.
          Length = 446

 Score =  175 bits (427), Expect = 4e-44
 Identities = 82/113 (72%), Positives = 89/113 (78%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARILSSGYP 340
           FDAKNMM ACDPRHGRYLTVA IFRG    K++       + K +       P
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIP 346



 Score =  167 bits (406), Expect = 1e-41
 Identities = 73/85 (85%), Positives = 81/85 (95%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS++FVEWIPNNCK AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKRVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AE014297-930|AAF54373.1|  446|Drosophila melanogaster CG9359-PA
           protein.
          Length = 446

 Score =  175 bits (427), Expect = 4e-44
 Identities = 82/113 (72%), Positives = 89/113 (78%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARILSSGYP 340
           FDAKNMM ACDPRHGRYLTVA IFRG    K++       + K +       P
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIP 346



 Score =  167 bits (406), Expect = 1e-41
 Identities = 73/85 (85%), Positives = 81/85 (95%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS++FVEWIPNNCK AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKRVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>M22335-1|AAA28993.1|  454|Drosophila melanogaster protein (
           D.melanogaster beta-3 tubulin gene, exons 2, 3 and 4. ).
          Length = 454

 Score =  175 bits (426), Expect = 5e-44
 Identities = 80/105 (76%), Positives = 88/105 (83%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 240 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 299

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVA +FRG    K++       + K +
Sbjct: 300 FDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNS 344



 Score =  163 bits (395), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  +QNKNS+YFVEWIPNN K AVCDIPPRGLKM+STFIGNTTAIQ +
Sbjct: 324 RGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSSTFIGNTTAIQEL 383

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 384 FKRISEQFSAMFRRKAFLHWYTGEG 408



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 399 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 432


>M20419-1|AAA28989.1|  447|Drosophila melanogaster protein (
           D.melanogaster beta-1 tubulin mRNA, complete cds. ).
          Length = 447

 Score =  175 bits (426), Expect = 5e-44
 Identities = 79/86 (91%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (399), Expect = 9e-41
 Identities = 72/85 (84%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BT015991-1|AAV36876.1|  454|Drosophila melanogaster RE53159p
           protein.
          Length = 454

 Score =  175 bits (426), Expect = 5e-44
 Identities = 80/105 (76%), Positives = 88/105 (83%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 240 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 299

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVA +FRG    K++       + K +
Sbjct: 300 FDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNS 344



 Score =  161 bits (392), Expect = 6e-40
 Identities = 71/85 (83%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  +QNKNS+YFVEWIPNN K AVCDIPP+GLKM+STFIGNTTAIQ +
Sbjct: 324 RGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQEL 383

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 384 FKRISEQFSAMFRRKAFLHWYTGEG 408



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 399 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 432


>BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p
           protein.
          Length = 447

 Score =  175 bits (426), Expect = 5e-44
 Identities = 79/86 (91%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (399), Expect = 9e-41
 Identities = 72/85 (84%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AE013599-3851|AAF47193.2|  454|Drosophila melanogaster CG3401-PA
           protein.
          Length = 454

 Score =  175 bits (426), Expect = 5e-44
 Identities = 80/105 (76%), Positives = 88/105 (83%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 240 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 299

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVA +FRG    K++       + K +
Sbjct: 300 FDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNS 344



 Score =  161 bits (392), Expect = 6e-40
 Identities = 71/85 (83%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  +QNKNS+YFVEWIPNN K AVCDIPP+GLKM+STFIGNTTAIQ +
Sbjct: 324 RGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQEL 383

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 384 FKRISEQFSAMFRRKAFLHWYTGEG 408



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 399 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 432


>AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD,
           isoform D protein.
          Length = 375

 Score =  175 bits (426), Expect = 5e-44
 Identities = 79/86 (91%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 162 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 221

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 222 FDAKNMMAACDPRHGRYLTVAAIFRG 247



 Score =  164 bits (399), Expect = 9e-41
 Identities = 72/85 (84%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 246 RGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 305

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 306 FKRISEQFTAMFRRKAFLHWYTGEG 330



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 321 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 354


>AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC,
           isoform C protein.
          Length = 375

 Score =  175 bits (426), Expect = 5e-44
 Identities = 79/86 (91%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 162 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 221

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 222 FDAKNMMAACDPRHGRYLTVAAIFRG 247



 Score =  164 bits (399), Expect = 9e-41
 Identities = 72/85 (84%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 246 RGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 305

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 306 FKRISEQFTAMFRRKAFLHWYTGEG 330



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 321 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 354


>AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA,
           isoform A protein.
          Length = 456

 Score =  175 bits (426), Expect = 5e-44
 Identities = 79/86 (91%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 243 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 302

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 303 FDAKNMMAACDPRHGRYLTVAAIFRG 328



 Score =  164 bits (399), Expect = 9e-41
 Identities = 72/85 (84%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 327 RGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 386

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 387 FKRISEQFTAMFRRKAFLHWYTGEG 411



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 402 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 435


>AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB,
           isoform B protein.
          Length = 447

 Score =  175 bits (426), Expect = 5e-44
 Identities = 79/86 (91%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (399), Expect = 9e-41
 Identities = 72/85 (84%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubulin
           protein.
          Length = 435

 Score =  172 bits (419), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 81/86 (94%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQY ALTVPELT QM
Sbjct: 221 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYGALTVPELTQQM 280

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 281 FDAKNMMAACDPRHGRYLTVAAIFRG 306



 Score =  166 bits (404), Expect = 2e-41
 Identities = 74/85 (87%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ NIQNKNS+YFVEWIPNN K AVCDIPPRGLKM+STFIGNTTAIQ +
Sbjct: 305 RGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSSTFIGNTTAIQEL 364

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 365 FKRISEQFSAMFRRKAFLHWYTGEG 389



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 380 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 413


>AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p
           protein.
          Length = 457

 Score =  169 bits (411), Expect = 3e-42
 Identities = 76/86 (88%), Positives = 81/86 (94%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT++G+QQYRALTV ELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAKGSQQYRALTVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDAKNMMTACDPRHGRYLTVACIFRG 319



 Score =  159 bits (385), Expect = 4e-39
 Identities = 69/85 (81%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G MSMKEVD Q+ N+Q+KNS+YFVEWIPNN K+AVCDIPPRGLKM++TFIGN+TAIQ I
Sbjct: 318 RGPMSMKEVDTQMYNVQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSATFIGNSTAIQEI 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDLISEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQ 426


>AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA
           protein.
          Length = 522

 Score =  169 bits (411), Expect = 3e-42
 Identities = 76/86 (88%), Positives = 81/86 (94%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT++G+QQYRALTV ELT QM
Sbjct: 299 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAKGSQQYRALTVAELTQQM 358

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA IFRG
Sbjct: 359 FDAKNMMTACDPRHGRYLTVACIFRG 384



 Score =  159 bits (385), Expect = 4e-39
 Identities = 69/85 (81%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G MSMKEVD Q+ N+Q+KNS+YFVEWIPNN K+AVCDIPPRGLKM++TFIGN+TAIQ I
Sbjct: 383 RGPMSMKEVDTQMYNVQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSATFIGNSTAIQEI 442

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 443 FKRISEQFTAMFRRKAFLHWYTGEG 467



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDLISEYQQYQ
Sbjct: 458 AFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQ 491


>AY089468-1|AAL90206.1|  462|Drosophila melanogaster AT27896p
           protein.
          Length = 462

 Score =  130 bits (315), Expect = 1e-30
 Identities = 55/85 (64%), Positives = 71/85 (83%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMS +EVD+ +  ++NKN   FV+WIPNN K A+CDIPPRGLKM++TFIGNTTAIQT+
Sbjct: 317 RGRMSPREVDQLMTGVRNKNINNFVDWIPNNIKTAICDIPPRGLKMSATFIGNTTAIQTL 376

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+R+ +  ++M RRKA LHWYTGEG
Sbjct: 377 FQRLLDASMSMLRRKAHLHWYTGEG 401



 Score =  113 bits (272), Expect = 2e-25
 Identities = 55/86 (63%), Positives = 63/86 (73%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SGITTCLRFPGQLNA LRK+ VNMVPFPRLHF  PGFAPL +   QQ+   TV EL  Q+
Sbjct: 233 SGITTCLRFPGQLNAGLRKIYVNMVPFPRLHFLIPGFAPLVTCKQQQFSKGTVSELVQQI 292

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           F + N++ A D R G+ LT A IFRG
Sbjct: 293 FYSNNLLCAIDLRKGKLLTAAGIFRG 318


>AE014296-1121|AAF50659.1|  462|Drosophila melanogaster CG32396-PA
           protein.
          Length = 462

 Score =  130 bits (315), Expect = 1e-30
 Identities = 55/85 (64%), Positives = 71/85 (83%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMS +EVD+ +  ++NKN   FV+WIPNN K A+CDIPPRGLKM++TFIGNTTAIQT+
Sbjct: 317 RGRMSPREVDQLMTGVRNKNINNFVDWIPNNIKTAICDIPPRGLKMSATFIGNTTAIQTL 376

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+R+ +  ++M RRKA LHWYTGEG
Sbjct: 377 FQRLLDASMSMLRRKAHLHWYTGEG 401



 Score =  113 bits (272), Expect = 2e-25
 Identities = 55/86 (63%), Positives = 63/86 (73%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SGITTCLRFPGQLNA LRK+ VNMVPFPRLHF  PGFAPL +   QQ+   TV EL  Q+
Sbjct: 233 SGITTCLRFPGQLNAGLRKIYVNMVPFPRLHFLIPGFAPLVTCKQQQFSKGTVSELVQQI 292

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           F + N++ A D R G+ LT A IFRG
Sbjct: 293 FYSNNLLCAIDLRKGKLLTAAGIFRG 318


>M14643-1|AAA28985.1|  450|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-1), complete
           cds. ).
          Length = 450

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BT012506-1|AAS93777.1|  450|Drosophila melanogaster AT25469p
           protein.
          Length = 450

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AE014297-554|AAF54067.1|  450|Drosophila melanogaster CG1913-PA
           protein.
          Length = 450

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>M14644-1|AAA28986.1|  449|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-2), complete
           cds. ).
          Length = 449

 Score = 88.6 bits (210), Expect = 7e-18
 Identities = 41/103 (39%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPR G+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AY113631-1|AAM29636.1|  449|Drosophila melanogaster RH71862p
           protein.
          Length = 449

 Score = 88.6 bits (210), Expect = 7e-18
 Identities = 41/103 (39%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPR G+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 7e-10
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVRINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AE014297-1015|AAF54433.1|  449|Drosophila melanogaster CG9476-PA
           protein.
          Length = 449

 Score = 88.6 bits (210), Expect = 7e-18
 Identities = 41/103 (39%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPR G+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>M14645-1|AAA28987.1|  450|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-3), complete
           cds. ).
          Length = 450

 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 40/103 (38%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV  DPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BT016118-1|AAV37003.1|  450|Drosophila melanogaster LD07757p
           protein.
          Length = 450

 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 40/103 (38%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV  DPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BT003630-1|AAO39634.1|  450|Drosophila melanogaster AT26363p
           protein.
          Length = 450

 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 40/103 (38%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV  DPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AY084208-1|AAL89946.1|  450|Drosophila melanogaster SD07763p
           protein.
          Length = 450

 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 40/103 (38%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV  DPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AE014297-627|AAN13341.1|  450|Drosophila melanogaster CG2512-PB,
           isoform B protein.
          Length = 450

 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 40/103 (38%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV  DPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AE014297-626|AAF54007.1|  450|Drosophila melanogaster CG2512-PA,
           isoform A protein.
          Length = 450

 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 40/103 (38%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV  DPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>M14646-1|AAA28988.1|  462|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-4), complete
           cds. ).
          Length = 462

 Score = 83.4 bits (197), Expect = 3e-16
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 2/105 (1%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS--RGAQQYRALTVPELTL 175
           S  T  LRF G +N DL +   N+VPFPR+HF    +APL S  R A +  A+T   LT 
Sbjct: 247 SSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITT--LTN 304

Query: 176 QMFDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
             F++ NMMV CDPR G+++    ++RG+ + K + +     ++K
Sbjct: 305 ACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSK 349



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAV-----CDIPPRGLKMAST-- 399
           C   +G +  K+V+  ++ I++K    FV+W P   KI +       +P   L   S   
Sbjct: 327 CMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRAC 386

Query: 400 -FIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   F  +S +F  MF+++AF+HWY GEG
Sbjct: 387 CMLSNTTAISVAFSNLSYKFDLMFKKRAFVHWYVGEG 423


>AE014296-1707|AAF50226.2|  462|Drosophila melanogaster CG8308-PA
           protein.
          Length = 462

 Score = 83.4 bits (197), Expect = 3e-16
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 2/105 (1%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS--RGAQQYRALTVPELTL 175
           S  T  LRF G +N DL +   N+VPFPR+HF    +APL S  R A +  A+T   LT 
Sbjct: 247 SSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITT--LTN 304

Query: 176 QMFDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
             F++ NMMV CDPR G+++    ++RG+ + K + +     ++K
Sbjct: 305 ACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSK 349



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAV-----CDIPPRGLKMAST-- 399
           C   +G +  K+V+  ++ I++K    FV+W P   KI +       +P   L   S   
Sbjct: 327 CMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRAC 386

Query: 400 -FIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   F  +S +F  MF+++AF+HWY GEG
Sbjct: 387 CMLSNTTAISVAFSNLSYKFDLMFKKRAFVHWYVGEG 423


>AY089253-1|AAL89991.1|  455|Drosophila melanogaster AT04270p
           protein.
          Length = 455

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/87 (34%), Positives = 47/87 (54%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S  T   RF G      ++L  N+VP+PR+H+    +APL      Q+  ++  +LT Q 
Sbjct: 237 SSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQC 296

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           F   N MV C+P HG+Y+    ++RG+
Sbjct: 297 FQMSNQMVRCNPSHGKYMASVLLYRGD 323



 Score = 52.4 bits (120), Expect = 6e-07
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMAST-----FIG 408
           +G ++  E++  L NI+   S  FV+W P   KI V  +PP    G  +A T      I 
Sbjct: 321 RGDIAPNEINTALENIKRNRSFRFVDWSPTGFKIGVSPMPPYYVPGGDLAPTNRACVAIS 380

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           N T I+  + R+  +F  +++R+AF++ Y GEG
Sbjct: 381 NNTNIRIAWCRLVNKFDKLYQRRAFVYHYVGEG 413


>AE014297-2432|AAF55488.1|  455|Drosophila melanogaster CG7794-PA
           protein.
          Length = 455

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/87 (34%), Positives = 47/87 (54%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S  T   RF G      ++L  N+VP+PR+H+    +APL      Q+  ++  +LT Q 
Sbjct: 237 SSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQC 296

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGE 262
           F   N MV C+P HG+Y+    ++RG+
Sbjct: 297 FQMSNQMVRCNPSHGKYMASVLLYRGD 323



 Score = 52.4 bits (120), Expect = 6e-07
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMAST-----FIG 408
           +G ++  E++  L NI+   S  FV+W P   KI V  +PP    G  +A T      I 
Sbjct: 321 RGDIAPNEINTALENIKRNRSFRFVDWSPTGFKIGVSPMPPYYVPGGDLAPTNRACVAIS 380

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           N T I+  + R+  +F  +++R+AF++ Y GEG
Sbjct: 381 NNTNIRIAWCRLVNKFDKLYQRRAFVYHYVGEG 413


>M61765-1|AAA28597.1|  475|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 475

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRG---AQQ---YRALTVPELT 172
           TT LR+P  +N +L  L   ++P P+LHF   G+ PLTS      QQ    R  TV ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTAPLIPTPQLHFLMTGYTPLTSDSDIHTQQLVNVRKTTVLDVM 299

Query: 173 LQMFDAKNMMVACDP---RHGRYLTVATIFRGE 262
            ++   KNMMV+  P    H  Y+++  I +GE
Sbjct: 300 RRLLQPKNMMVSTGPDKSNHHCYISILNIIQGE 332



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG +   +V + L  I+++    F+ W P + ++A+    P      +++   + N T+
Sbjct: 329 IQGEVDPTQVHKSLQRIRDRKMAQFIPWGPTSIQVALSRSSPYVQSNHRVSGLMLANHTS 388

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+R   Q+  + +R AFL  +  E   K
Sbjct: 389 ICSLFERALNQYDNVRKRGAFLDQFRREDIFK 420


>AY069633-1|AAL39778.1|  475|Drosophila melanogaster LD40196p
           protein.
          Length = 475

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRG---AQQ---YRALTVPELT 172
           TT LR+P  +N +L  L   ++P P+LHF   G+ PLTS      QQ    R  TV ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTAPLIPTPQLHFLMTGYTPLTSDSDIHTQQLVNVRKTTVLDVM 299

Query: 173 LQMFDAKNMMVACDP---RHGRYLTVATIFRGE 262
            ++   KNMMV+  P    H  Y+++  I +GE
Sbjct: 300 RRLLQPKNMMVSTGPDKSNHHCYISILNIIQGE 332



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG +   +V + L  I+++    F+ W P + ++A+    P      +++   + N T+
Sbjct: 329 IQGEVDPTQVHKSLQRIRDRKMAQFIPWGPTSIQVALSRSSPYVQSNHRVSGLMLANHTS 388

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+R   Q+  + +R AFL  +  E   K
Sbjct: 389 ICSLFERALNQYDKLRKRGAFLDQFRREDIFK 420


>AF073994-1|AAC27620.1|  333|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 333

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRG---AQQ---YRALTVPELT 172
           TT LR+P  +N +L  L   ++P P+LHF   G+ PLTS      QQ    R  TV ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTAPLIPTPQLHFLMTGYTPLTSDSDIHTQQLVNVRKTTVLDVM 299

Query: 173 LQMFDAKNMMVACDP---RHGRYLTVATIFRGE 262
            ++   KNMMV+  P    H  Y+++  I +GE
Sbjct: 300 RRLLQPKNMMVSTGPDKSNHHCYISILNIIQGE 332


>AE014134-523|AAF51174.1|  475|Drosophila melanogaster CG3157-PA
           protein.
          Length = 475

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRG---AQQ---YRALTVPELT 172
           TT LR+P  +N +L  L   ++P P+LHF   G+ PLTS      QQ    R  TV ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTAPLIPTPQLHFLMTGYTPLTSDSDIHTQQLVNVRKTTVLDVM 299

Query: 173 LQMFDAKNMMVACDP---RHGRYLTVATIFRGE 262
            ++   KNMMV+  P    H  Y+++  I +GE
Sbjct: 300 RRLLQPKNMMVSTGPDKSNHHCYISILNIIQGE 332



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG +   +V + L  I+++    F+ W P + ++A+    P      +++   + N T+
Sbjct: 329 IQGEVDPTQVHKSLQRIRDRKMAQFIPWGPTSIQVALSRSSPYVQSNHRVSGLMLANHTS 388

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+R   Q+  + +R AFL  +  E   K
Sbjct: 389 ICSLFERALNQYDKLRKRGAFLDQFRREDIFK 420


>M76765-1|AAB52553.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS--RGAQQYRALTVPELTLQMF 184
           TT LR+P  +N +L  L  +++P P+LHF   G+ PL S        R  TV ++  ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTASLIPTPQLHFLMTGYTPLMSDCEAKTSVRKTTVLDVMRRLL 299

Query: 185 DAKNMMV-ACDPRHGR--YLTVATIFRGE 262
             KNMMV A   +  R  ++++  I +GE
Sbjct: 300 QPKNMMVSALTDKQSRQCFVSILNIIQGE 328



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 3/82 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+    P      K++   + N T 
Sbjct: 325 IQGEVDPSQVHKSLQRIRERKLANFIPWGPASIQVALPRSSPYVQSAHKVSGLMMANHTG 384

Query: 421 IQTIFKRVSEQFVAMFRRKAFL 486
           I ++FKR   Q+  + +R AFL
Sbjct: 385 ISSLFKRALAQYDKLRKRNAFL 406


>AY070558-1|AAL48029.1|  457|Drosophila melanogaster LD32755p
           protein.
          Length = 457

 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS--RGAQQYRALTVPELTLQMF 184
           TT LR+P  +N +L  L  +++P P+LHF   G+ PL S        R  TV ++  ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTASLIPTPQLHFLMTGYTPLMSDCETKTSVRKTTVLDVMRRLL 299

Query: 185 DAKNMMV-ACDPRHGR--YLTVATIFRGE 262
             KNMMV A   +  R  ++++  I +GE
Sbjct: 300 QPKNMMVSALTDKQSRQCFVSILNIIQGE 328



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 3/82 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+    P      K++   + N T 
Sbjct: 325 IQGEVDPSQVHKSLQRIRERKLANFIPWGPASIQVALPRSSPYVQSAHKVSGLMMANHTG 384

Query: 421 IQTIFKRVSEQFVAMFRRKAFL 486
           I ++FKR   Q+  + +R AFL
Sbjct: 385 ISSLFKRALAQYDKLRKRNAFL 406


>AJ010552-1|CAA09233.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS--RGAQQYRALTVPELTLQMF 184
           TT LR+P  +N +L  L  +++P P+LHF   G+ PL S        R  TV ++  ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTASLIPTPQLHFLMTGYTPLMSDCETKTSVRKTTVLDVMRRLL 299

Query: 185 DAKNMMV-ACDPRHGR--YLTVATIFRGE 262
             KNMMV A   +  R  ++++  I +GE
Sbjct: 300 QPKNMMVSALTDKQSRQCFVSILNIIQGE 328



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 3/82 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+    P      K++   + N T 
Sbjct: 325 IQGEVDPSQVHKSLQRIRERKLANFIPWGPASIQVALPRSSPYVQSAHKVSGLMMANHTG 384

Query: 421 IQTIFKRVSEQFVAMFRRKAFL 486
           I ++FKR   Q+  + +R AFL
Sbjct: 385 ISSLFKRALAQYDKLRKRNAFL 406


>AF091265-1|AAC64117.1|  457|Drosophila melanogaster gamma-tubulin
           37CD protein.
          Length = 457

 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS--RGAQQYRALTVPELTLQMF 184
           TT LR+P  +N +L  L  +++P P+LHF   G+ PL S        R  TV ++  ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTASLIPTPQLHFLMTGYTPLMSDCETKTSVRKTTVLDVMRRLL 299

Query: 185 DAKNMMV-ACDPRHGR--YLTVATIFRGE 262
             KNMMV A   +  R  ++++  I +GE
Sbjct: 300 QPKNMMVSALTDKQSRQCFVSILNIIQGE 328



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 3/82 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+    P      K++   + N T 
Sbjct: 325 IQGEVDPSQVHKSLQRIRERKLANFIPWGPASIQVALPRSSPYVQSAHKVSGLMMANHTG 384

Query: 421 IQTIFKRVSEQFVAMFRRKAFL 486
           I ++FKR   Q+  + +R AFL
Sbjct: 385 ISSLFKRALAQYDKLRKRNAFL 406


>AF081253-1|AAC35844.1|  351|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 351

 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS--RGAQQYRALTVPELTLQMF 184
           TT LR+P  +N +L  L  +++P P+LHF   G+ PL S        R  TV ++  ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTASLIPTPQLHFLMTGYTPLMSDCETKTSVRKTTVLDVMRRLL 299

Query: 185 DAKNMMV-ACDPRHGR--YLTVATIFRGE 262
             KNMMV A   +  R  ++++  I +GE
Sbjct: 300 QPKNMMVSALTDKQSRQCFVSILNIIQGE 328


>AF081252-1|AAC35843.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS--RGAQQYRALTVPELTLQMF 184
           TT LR+P  +N +L  L  +++P P+LHF   G+ PL S        R  TV ++  ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTASLIPTPQLHFLMTGYTPLMSDCETKTSVRKTTVLDVMRRLL 299

Query: 185 DAKNMMV-ACDPRHGR--YLTVATIFRGE 262
             KNMMV A   +  R  ++++  I +GE
Sbjct: 300 QPKNMMVSALTDKQSRQCFVSILNIIQGE 328



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 3/82 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+    P      K++   + N T 
Sbjct: 325 IQGEVDPSQVHKSLQRIRKRKLANFIPWGPASIQVALPRSSPYVQSAHKVSGLMMANHTG 384

Query: 421 IQTIFKRVSEQFVAMFRRKAFL 486
           I ++FKR   Q+  + +R AFL
Sbjct: 385 ISSLFKRALAQYDKLRKRNAFL 406


>AE014134-3061|AAF53774.1|  457|Drosophila melanogaster CG17566-PA
           protein.
          Length = 457

 Score = 52.0 bits (119), Expect = 8e-07
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +2

Query: 11  TTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS--RGAQQYRALTVPELTLQMF 184
           TT LR+P  +N +L  L  +++P P+LHF   G+ PL S        R  TV ++  ++ 
Sbjct: 240 TTTLRYPSYMNNNLIGLTASLIPTPQLHFLMTGYTPLMSDCETKTSVRKTTVLDVMRRLL 299

Query: 185 DAKNMMV-ACDPRHGR--YLTVATIFRGE 262
             KNMMV A   +  R  ++++  I +GE
Sbjct: 300 QPKNMMVSALTDKQSRQCFVSILNIIQGE 328



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 3/82 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+    P      K++   + N T 
Sbjct: 325 IQGEVDPSQVHKSLQRIRERKLANFIPWGPASIQVALPRSSPYVQSAHKVSGLMMANHTG 384

Query: 421 IQTIFKRVSEQFVAMFRRKAFL 486
           I ++FKR   Q+  + +R AFL
Sbjct: 385 ISSLFKRALAQYDKLRKRNAFL 406


>AY327466-1|AAQ16306.1|  381|Drosophila melanogaster
           peptidoglycan-recognition protein-LC splice variant LCy
           protein.
          Length = 381

 Score = 31.1 bits (67), Expect = 1.5
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = -2

Query: 379 PSEVCHTRQSCSYWVSTRQN 320
           P E+C T+ SCSYW    Q+
Sbjct: 239 PPEICKTQDSCSYWTRVTQS 258


>AE014296-1609|AAS65052.1|  511|Drosophila melanogaster CG4432-PC,
           isoform C protein.
          Length = 511

 Score = 30.7 bits (66), Expect = 2.0
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = -2

Query: 379 PSEVCHTRQSCSYWVSTRQN 320
           P E+C T+ SCSYW    Q+
Sbjct: 368 PPEICTTQDSCSYWTRVTQS 387


>AY089407-1|AAL90145.1|  440|Drosophila melanogaster AT23003p
           protein.
          Length = 440

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 15/56 (26%), Positives = 30/56 (53%)
 Frame = +1

Query: 265 SMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           SM  +DEQ  N+ + ++  FVEW+ N+      ++ P  +K   +  G+ T + ++
Sbjct: 246 SMVTLDEQAENLMDASAERFVEWL-NSFGTLESNLTPEKVKNLFSIKGDRTLLASV 300


>AE014297-812|AAF54285.2|  440|Drosophila melanogaster CG8236-PA
           protein.
          Length = 440

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 15/56 (26%), Positives = 30/56 (53%)
 Frame = +1

Query: 265 SMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           SM  +DEQ  N+ + ++  FVEW+ N+      ++ P  +K   +  G+ T + ++
Sbjct: 246 SMVTLDEQAENLMDASAERFVEWL-NSFGTLESNLTPEKVKNLFSIKGDRTLLASV 300


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,003,708
Number of Sequences: 53049
Number of extensions: 623723
Number of successful extensions: 2166
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 1954
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2138
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3067209849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).