SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0029
         (499 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF181098-1|AAD53186.1|  474|Drosophila melanogaster synaptotagmi...    30   2.0  
AE014297-591|AAF54037.2|  474|Drosophila melanogaster CG10047-PA...    30   2.0  
AY051637-1|AAK93061.1|  743|Drosophila melanogaster GH28826p pro...    29   3.5  
AE014298-1129|AAF46328.1|  743|Drosophila melanogaster CG10958-P...    29   3.5  
BT024225-1|ABC86287.1|  805|Drosophila melanogaster LP17019p pro...    29   4.6  
AY071620-1|AAL49242.1|  474|Drosophila melanogaster RE67111p pro...    29   4.6  
AE014296-1770|AAF50192.1|  161|Drosophila melanogaster CG14166-P...    29   4.6  

>AF181098-1|AAD53186.1|  474|Drosophila melanogaster synaptotagmin
           IV protein.
          Length = 474

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = +1

Query: 295 SDEYGRRARVELRSAYVAPRSSRALEAVRCRG 390
           +D+YG+   +  +  Y+A R++  +  +RCRG
Sbjct: 174 TDQYGKLGTIYFKLRYLAERNALMVSIIRCRG 205


>AE014297-591|AAF54037.2|  474|Drosophila melanogaster CG10047-PA
           protein.
          Length = 474

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = +1

Query: 295 SDEYGRRARVELRSAYVAPRSSRALEAVRCRG 390
           +D+YG+   +  +  Y+A R++  +  +RCRG
Sbjct: 174 TDQYGKLGTIYFKLRYLAERNALMVSIIRCRG 205


>AY051637-1|AAK93061.1|  743|Drosophila melanogaster GH28826p
           protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = -3

Query: 401 PTSEPRQRTASRALEDRGATYAERSSTRALRPYSSEER 288
           P S    R   R L DRG    E    + L PYS EE+
Sbjct: 505 PDSLRLMRNLIRKLSDRGGFLIEERLLKILEPYSEEEK 542


>AE014298-1129|AAF46328.1|  743|Drosophila melanogaster CG10958-PA
           protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = -3

Query: 401 PTSEPRQRTASRALEDRGATYAERSSTRALRPYSSEER 288
           P S    R   R L DRG    E    + L PYS EE+
Sbjct: 505 PDSLRLMRNLIRKLSDRGGFLIEERLLKILEPYSEEEK 542


>BT024225-1|ABC86287.1|  805|Drosophila melanogaster LP17019p
           protein.
          Length = 805

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = -1

Query: 427 IKRPVADISQHPNHDSEQPPELLKTAVPRTRSEAQRAL 314
           I RP+A   QH  H+S Q P+L   A   +R  A + L
Sbjct: 94  IIRPIAP-HQHQQHESHQEPQLRNFAAANSRPHAAQLL 130


>AY071620-1|AAL49242.1|  474|Drosophila melanogaster RE67111p
           protein.
          Length = 474

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 10/32 (31%), Positives = 19/32 (59%)
 Frame = +1

Query: 295 SDEYGRRARVELRSAYVAPRSSRALEAVRCRG 390
           +D+YG+   +  +  Y+A R++  +   RCRG
Sbjct: 174 TDQYGKLGTIYFKLRYLAERNALMVSITRCRG 205


>AE014296-1770|AAF50192.1|  161|Drosophila melanogaster CG14166-PA
           protein.
          Length = 161

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = -1

Query: 427 IKRPVADISQHPNHDSEQPPELLKTAVPRTRSEAQRAL 314
           I RP+A   QH  H+S Q P+L   A   +R  A + L
Sbjct: 94  IIRPIAP-HQHQQHESHQEPQLRNFAAANSRPHAAQLL 130


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,908,544
Number of Sequences: 53049
Number of extensions: 372543
Number of successful extensions: 1490
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1404
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1488
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1763278080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).