SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0028
         (598 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY089394-1|AAL90132.1|  250|Drosophila melanogaster AT21920p pro...    31   1.2  
AE013599-2228|AAF58034.2|  250|Drosophila melanogaster CG15708-P...    31   1.2  
BT015210-1|AAT94439.1|  462|Drosophila melanogaster RE57622p pro...    30   2.1  
AE014298-2831|AAF48946.2|  462|Drosophila melanogaster CG8028-PA...    30   2.1  

>AY089394-1|AAL90132.1|  250|Drosophila melanogaster AT21920p
           protein.
          Length = 250

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 151 LPGSTQINRKCFREGESRRAPSAGPML-PVAAVTRRP 258
           L  ST   RKC+R    R AP+ G +  P  A +RRP
Sbjct: 132 LENSTSHRRKCYRASIERWAPAEGRIFCPCCATSRRP 168


>AE013599-2228|AAF58034.2|  250|Drosophila melanogaster CG15708-PA
           protein.
          Length = 250

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 151 LPGSTQINRKCFREGESRRAPSAGPML-PVAAVTRRP 258
           L  ST   RKC+R    R AP+ G +  P  A +RRP
Sbjct: 132 LENSTSHRRKCYRASIERWAPAEGRIFCPCCATSRRP 168


>BT015210-1|AAT94439.1|  462|Drosophila melanogaster RE57622p
           protein.
          Length = 462

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -3

Query: 194 PSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPASQPYT 78
           P+ +  L  C  PGST  C    P+  P+KGSP +  ++
Sbjct: 394 PASRRSLDFCA-PGSTFHCLWSLPTTCPRKGSPLAMAFS 431


>AE014298-2831|AAF48946.2|  462|Drosophila melanogaster CG8028-PA
           protein.
          Length = 462

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = -3

Query: 194 PSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPASQPYT 78
           P+ +  L  C  PGST  C    P+  P+KGSP +  ++
Sbjct: 394 PASRRSLDFCA-PGSTFHCLWSLPTTCPRKGSPLAMAFS 431


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,909,434
Number of Sequences: 53049
Number of extensions: 585746
Number of successful extensions: 2177
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1890
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2174
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2420893683
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).