SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0023
         (289 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY071725-1|AAL49347.1|   92|Drosophila melanogaster RH41593p pro...   157   2e-39
AY071189-1|AAL48811.1|   92|Drosophila melanogaster RE23595p pro...   157   2e-39
AE014134-878|AAN10530.1|   92|Drosophila melanogaster CG5827-PB,...   157   2e-39
AE014134-877|AAF52217.1|   92|Drosophila melanogaster CG5827-PA,...   157   2e-39
AE013599-1898|AAF58242.1| 1290|Drosophila melanogaster CG17390-P...    31   0.32 
AE014296-3238|AAF49100.3| 1736|Drosophila melanogaster CG8334-PA...    30   0.55 
BT025932-1|ABG02176.1|  918|Drosophila melanogaster IP13252p pro...    29   0.73 
BT023818-1|AAZ86739.1|  909|Drosophila melanogaster SD18573p pro...    27   2.9  
AY128427-1|AAM75020.1|  558|Drosophila melanogaster GH23001p pro...    27   2.9  
AM262815-1|CAK18655.1| 1518|Drosophila melanogaster PP1 interact...    27   2.9  
AJ277094-1|CAB83192.1| 1192|Drosophila melanogaster kurz protein...    27   2.9  
AE014297-3239|AAO41591.1| 1744|Drosophila melanogaster CG7029-PA...    27   2.9  
EF057934-1|ABL84869.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057933-1|ABL84868.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057932-1|ABL84867.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057931-1|ABL84866.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057930-1|ABL84865.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057929-1|ABL84864.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057928-1|ABL84863.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057927-1|ABL84862.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057926-1|ABL84861.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057925-1|ABL84860.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057924-1|ABL84859.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
EF057923-1|ABL84858.1|  668|Drosophila melanogaster Nup75 protein.     27   3.9  
AY070887-1|AAL48509.1|  668|Drosophila melanogaster LD29726p pro...    27   3.9  
AE013599-2638|AAF57735.1|  668|Drosophila melanogaster CG5733-PA...    27   3.9  
AE014134-2074|AAF53104.1|  129|Drosophila melanogaster CG14929-P...    27   5.1  
L35153-1|AAA64457.1|  857|Drosophila melanogaster polycomblike n...    26   6.8  
AY075585-1|AAL68389.1| 1043|Drosophila melanogaster SD09488p pro...    26   6.8  
AE013599-2620|AAF57748.2| 1043|Drosophila melanogaster CG5109-PA...    26   6.8  
Z22228-1|CAA80230.1|  139|Drosophila melanogaster lysozyme precu...    26   9.0  
X64418-1|CAB55570.1| 1090|Drosophila melanogaster kurz protein p...    26   9.0  
U58282-1|AAB17949.1|  744|Drosophila melanogaster Bowel protein.       26   9.0  
BT022831-1|AAY55247.1|  665|Drosophila melanogaster IP13359p pro...    26   9.0  
BT010294-1|AAQ23612.1|  744|Drosophila melanogaster LD15350p pro...    26   9.0  
BT010244-1|AAQ23562.1| 1192|Drosophila melanogaster RE43077p pro...    26   9.0  
AY119049-1|AAM50909.1|  140|Drosophila melanogaster LP06719p pro...    26   9.0  
AL009195-2|CAA15706.1| 1192|Drosophila melanogaster EG:30B8.2,FB...    26   9.0  
AE014298-366|AAF45757.1| 1192|Drosophila melanogaster CG3228-PA ...    26   9.0  
AE014296-192|AAF47453.1|  140|Drosophila melanogaster CG1165-PA ...    26   9.0  
AE014134-2568|AAF53440.2|  587|Drosophila melanogaster CG15269-P...    26   9.0  
AE014134-674|AAF51063.1|  744|Drosophila melanogaster CG10021-PD...    26   9.0  
AE014134-673|AAN10360.1|  744|Drosophila melanogaster CG10021-PC...    26   9.0  
AE014134-672|AAF51064.1|  744|Drosophila melanogaster CG10021-PB...    26   9.0  
AE014134-671|AAF51065.1|  744|Drosophila melanogaster CG10021-PA...    26   9.0  
AE013599-2587|AAM68477.1|  750|Drosophila melanogaster CG30325-P...    26   9.0  

>AY071725-1|AAL49347.1|   92|Drosophila melanogaster RH41593p
           protein.
          Length = 92

 Score =  157 bits (382), Expect = 2e-39
 Identities = 69/76 (90%), Positives = 74/76 (97%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKKME+TQH+KYTCSFCGKD+MKR+ VGIWSCKRC
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRC 60

Query: 206 KRTVAGGAWVFSTTAA 253
           KRTVAGGAWV+STTAA
Sbjct: 61  KRTVAGGAWVYSTTAA 76


>AY071189-1|AAL48811.1|   92|Drosophila melanogaster RE23595p
           protein.
          Length = 92

 Score =  157 bits (382), Expect = 2e-39
 Identities = 69/76 (90%), Positives = 74/76 (97%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKKME+TQH+KYTCSFCGKD+MKR+ VGIWSCKRC
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRC 60

Query: 206 KRTVAGGAWVFSTTAA 253
           KRTVAGGAWV+STTAA
Sbjct: 61  KRTVAGGAWVYSTTAA 76


>AE014134-878|AAN10530.1|   92|Drosophila melanogaster CG5827-PB,
           isoform B protein.
          Length = 92

 Score =  157 bits (382), Expect = 2e-39
 Identities = 69/76 (90%), Positives = 74/76 (97%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKKME+TQH+KYTCSFCGKD+MKR+ VGIWSCKRC
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRC 60

Query: 206 KRTVAGGAWVFSTTAA 253
           KRTVAGGAWV+STTAA
Sbjct: 61  KRTVAGGAWVYSTTAA 76


>AE014134-877|AAF52217.1|   92|Drosophila melanogaster CG5827-PA,
           isoform A protein.
          Length = 92

 Score =  157 bits (382), Expect = 2e-39
 Identities = 69/76 (90%), Positives = 74/76 (97%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKKME+TQH+KYTCSFCGKD+MKR+ VGIWSCKRC
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRC 60

Query: 206 KRTVAGGAWVFSTTAA 253
           KRTVAGGAWV+STTAA
Sbjct: 61  KRTVAGGAWVYSTTAA 76


>AE013599-1898|AAF58242.1| 1290|Drosophila melanogaster CG17390-PA
           protein.
          Length = 1290

 Score = 30.7 bits (66), Expect = 0.32
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +2

Query: 59  GKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGK 157
           G YG+ +G S   M+  M   +H  + C +C K
Sbjct: 219 GWYGSEFGLSAYGMLMAMSHAEHLPFKCEYCSK 251


>AE014296-3238|AAF49100.3| 1736|Drosophila melanogaster CG8334-PA
           protein.
          Length = 1736

 Score = 29.9 bits (64), Expect = 0.55
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +2

Query: 110 MEVTQHAKYTCSFCGKDAMKRSCV 181
           M+ TQH  +TC +C + A +R+ V
Sbjct: 353 MQYTQHTTHTCDYCKRTASQRTAV 376


>BT025932-1|ABG02176.1|  918|Drosophila melanogaster IP13252p
           protein.
          Length = 918

 Score = 29.5 bits (63), Expect = 0.73
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = -2

Query: 126 CWVTSIFLTILRREAP*RVPYLPVIPTFLVRLAILVNLSDT 4
           C V SI LTI       R+PY+ +I  FL  L++L+NL  T
Sbjct: 543 CVVLSI-LTIALTAIGLRIPYMCMISLFLYILSLLINLLTT 582


>BT023818-1|AAZ86739.1|  909|Drosophila melanogaster SD18573p
           protein.
          Length = 909

 Score = 27.5 bits (58), Expect = 2.9
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = -2

Query: 240 ENTQ-APPATVLLHRLQ-DQMPTQERFIASLPQNEQVYFA 127
           E++Q APP    L R   D     E F+ASLP++E  Y+A
Sbjct: 607 EHSQPAPPVKQRLSRKDLDARARAESFLASLPRSELKYYA 646


>AY128427-1|AAM75020.1|  558|Drosophila melanogaster GH23001p
           protein.
          Length = 558

 Score = 27.5 bits (58), Expect = 2.9
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = -2

Query: 240 ENTQ-APPATVLLHRLQ-DQMPTQERFIASLPQNEQVYFA 127
           E++Q APP    L R   D     E F+ASLP++E  Y+A
Sbjct: 256 EHSQPAPPVKQRLSRKDLDARARAESFLASLPRSELKYYA 295


>AM262815-1|CAK18655.1| 1518|Drosophila melanogaster PP1 interacting
            16 protein.
          Length = 1518

 Score = 27.5 bits (58), Expect = 2.9
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = -2

Query: 240  ENTQ-APPATVLLHRLQ-DQMPTQERFIASLPQNEQVYFA 127
            E++Q APP    L R   D     E F+ASLP++E  Y+A
Sbjct: 1216 EHSQPAPPVKQRLSRKDLDARARAESFLASLPRSELKYYA 1255


>AJ277094-1|CAB83192.1| 1192|Drosophila melanogaster kurz protein
           protein.
          Length = 1192

 Score = 27.5 bits (58), Expect = 2.9
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 4/52 (7%)
 Frame = -2

Query: 252 AAVVENTQAPPATVLLHRLQDQMPTQERF----IASLPQNEQVYFACWVTSI 109
           AA  ENT  PPA   L  +  + P   RF      S  QN   Y  C V ++
Sbjct: 779 AAKTENTDLPPAVTRLGHVISRFPVAPRFGKMLALSHQQNLLPYTVCLVAAL 830


>AE014297-3239|AAO41591.1| 1744|Drosophila melanogaster CG7029-PA
            protein.
          Length = 1744

 Score = 27.5 bits (58), Expect = 2.9
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = -2

Query: 240  ENTQ-APPATVLLHRLQ-DQMPTQERFIASLPQNEQVYFA 127
            E++Q APP    L R   D     E F+ASLP++E  Y+A
Sbjct: 1442 EHSQPAPPVKQRLSRKDLDARARAESFLASLPRSELKYYA 1481


>EF057934-1|ABL84869.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057933-1|ABL84868.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057932-1|ABL84867.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057931-1|ABL84866.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057930-1|ABL84865.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057929-1|ABL84864.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057928-1|ABL84863.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057927-1|ABL84862.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057926-1|ABL84861.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057925-1|ABL84860.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057924-1|ABL84859.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>EF057923-1|ABL84858.1|  668|Drosophila melanogaster Nup75 protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>AY070887-1|AAL48509.1|  668|Drosophila melanogaster LD29726p
           protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>AE013599-2638|AAF57735.1|  668|Drosophila melanogaster CG5733-PA
           protein.
          Length = 668

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWH 72
           VYQ G   QK  + W+ WH
Sbjct: 243 VYQEGYALQKFHSQWEFWH 261


>AE014134-2074|AAF53104.1|  129|Drosophila melanogaster CG14929-PA,
           isoform A protein.
          Length = 129

 Score = 26.6 bits (56), Expect = 5.1
 Identities = 15/44 (34%), Positives = 19/44 (43%)
 Frame = +2

Query: 128 AKYTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAAYH 259
           AK   S   +D M R C   W C +CK  V    W  S   A++
Sbjct: 37  AKREVSPYAEDLMNRFCC--WRCDKCKEDVQVKPWQESMVDAWN 78


>L35153-1|AAA64457.1|  857|Drosophila melanogaster polycomblike
           nuclear protein protein.
          Length = 857

 Score = 26.2 bits (55), Expect = 6.8
 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 7/31 (22%)
 Frame = +2

Query: 140 CSFCGKDAMKRSCV-------GIWSCKRCKR 211
           C  CG+    R C        GIWSCKRC +
Sbjct: 442 CERCGR-GYHRGCTVEIVTGSGIWSCKRCAK 471


>AY075585-1|AAL68389.1| 1043|Drosophila melanogaster SD09488p
           protein.
          Length = 1043

 Score = 26.2 bits (55), Expect = 6.8
 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 7/31 (22%)
 Frame = +2

Query: 140 CSFCGKDAMKRSCV-------GIWSCKRCKR 211
           C  CG+    R C        GIWSCKRC +
Sbjct: 442 CERCGR-GYHRGCTVEIVTGSGIWSCKRCAK 471


>AE013599-2620|AAF57748.2| 1043|Drosophila melanogaster CG5109-PA
           protein.
          Length = 1043

 Score = 26.2 bits (55), Expect = 6.8
 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 7/31 (22%)
 Frame = +2

Query: 140 CSFCGKDAMKRSCV-------GIWSCKRCKR 211
           C  CG+    R C        GIWSCKRC +
Sbjct: 442 CERCGR-GYHRGCTVEIVTGSGIWSCKRCAK 471


>Z22228-1|CAA80230.1|  139|Drosophila melanogaster lysozyme
           precursor protein.
          Length = 139

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 40  QKGWNYWQIWH 72
           Q+GW+ W +WH
Sbjct: 116 QQGWSAWAVWH 126


>X64418-1|CAB55570.1| 1090|Drosophila melanogaster kurz protein
           protein.
          Length = 1090

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 4/51 (7%)
 Frame = -2

Query: 249 AVVENTQAPPATVLLHRLQDQMPTQERF----IASLPQNEQVYFACWVTSI 109
           A  ENT  PPA   L  +  + P   RF      S  QN   Y  C V ++
Sbjct: 691 AKTENTDLPPAVTRLGHVISRFPVAPRFGKMLALSHQQNLLPYTVCLVAAL 741


>U58282-1|AAB17949.1|  744|Drosophila melanogaster Bowel protein.
          Length = 744

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +2

Query: 119 TQHAKYTCSFCGKDAMKRSC 178
           T H  Y CS CGK   +R+C
Sbjct: 345 TDHKPYECSSCGK-VFRRNC 363


>BT022831-1|AAY55247.1|  665|Drosophila melanogaster IP13359p
           protein.
          Length = 665

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 15/27 (55%), Positives = 16/27 (59%)
 Frame = +2

Query: 95  KMVKKMEVTQHAKYTCSFCGKDAMKRS 175
           K VKK E +QH K TCS C     KRS
Sbjct: 572 KDVKK-EPSQHFKKTCSLCKCVRRKRS 597


>BT010294-1|AAQ23612.1|  744|Drosophila melanogaster LD15350p
           protein.
          Length = 744

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +2

Query: 119 TQHAKYTCSFCGKDAMKRSC 178
           T H  Y CS CGK   +R+C
Sbjct: 345 TDHKPYECSSCGK-VFRRNC 363


>BT010244-1|AAQ23562.1| 1192|Drosophila melanogaster RE43077p
           protein.
          Length = 1192

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 4/51 (7%)
 Frame = -2

Query: 249 AVVENTQAPPATVLLHRLQDQMPTQERF----IASLPQNEQVYFACWVTSI 109
           A  ENT  PPA   L  +  + P   RF      S  QN   Y  C V ++
Sbjct: 780 AKTENTDLPPAVTRLGHVISRFPVAPRFGKMLALSHQQNLLPYTVCLVAAL 830


>AY119049-1|AAM50909.1|  140|Drosophila melanogaster LP06719p
           protein.
          Length = 140

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 40  QKGWNYWQIWH 72
           Q+GW+ W +WH
Sbjct: 117 QQGWSAWAVWH 127


>AL009195-2|CAA15706.1| 1192|Drosophila melanogaster
           EG:30B8.2,FBgn0001330;kz protein.
          Length = 1192

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 4/51 (7%)
 Frame = -2

Query: 249 AVVENTQAPPATVLLHRLQDQMPTQERF----IASLPQNEQVYFACWVTSI 109
           A  ENT  PPA   L  +  + P   RF      S  QN   Y  C V ++
Sbjct: 780 AKTENTDLPPAVTRLGHVISRFPVAPRFGKMLALSHQQNLLPYTVCLVAAL 830


>AE014298-366|AAF45757.1| 1192|Drosophila melanogaster CG3228-PA
           protein.
          Length = 1192

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 4/51 (7%)
 Frame = -2

Query: 249 AVVENTQAPPATVLLHRLQDQMPTQERF----IASLPQNEQVYFACWVTSI 109
           A  ENT  PPA   L  +  + P   RF      S  QN   Y  C V ++
Sbjct: 780 AKTENTDLPPAVTRLGHVISRFPVAPRFGKMLALSHQQNLLPYTVCLVAAL 830


>AE014296-192|AAF47453.1|  140|Drosophila melanogaster CG1165-PA
           protein.
          Length = 140

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 40  QKGWNYWQIWH 72
           Q+GW+ W +WH
Sbjct: 117 QQGWSAWAVWH 127


>AE014134-2568|AAF53440.2|  587|Drosophila melanogaster CG15269-PA
           protein.
          Length = 587

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 3/31 (9%)
 Frame = +2

Query: 92  RKMVKKMEVTQHA---KYTCSFCGKDAMKRS 175
           RKM+ K  +  H+    Y CS CGK    RS
Sbjct: 422 RKMLLKQHMRTHSGEKPYQCSVCGKSFADRS 452


>AE014134-674|AAF51063.1|  744|Drosophila melanogaster CG10021-PD,
           isoform D protein.
          Length = 744

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +2

Query: 119 TQHAKYTCSFCGKDAMKRSC 178
           T H  Y CS CGK   +R+C
Sbjct: 345 TDHKPYECSSCGK-VFRRNC 363


>AE014134-673|AAN10360.1|  744|Drosophila melanogaster CG10021-PC,
           isoform C protein.
          Length = 744

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +2

Query: 119 TQHAKYTCSFCGKDAMKRSC 178
           T H  Y CS CGK   +R+C
Sbjct: 345 TDHKPYECSSCGK-VFRRNC 363


>AE014134-672|AAF51064.1|  744|Drosophila melanogaster CG10021-PB,
           isoform B protein.
          Length = 744

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +2

Query: 119 TQHAKYTCSFCGKDAMKRSC 178
           T H  Y CS CGK   +R+C
Sbjct: 345 TDHKPYECSSCGK-VFRRNC 363


>AE014134-671|AAF51065.1|  744|Drosophila melanogaster CG10021-PA,
           isoform A protein.
          Length = 744

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +2

Query: 119 TQHAKYTCSFCGKDAMKRSC 178
           T H  Y CS CGK   +R+C
Sbjct: 345 TDHKPYECSSCGK-VFRRNC 363


>AE013599-2587|AAM68477.1|  750|Drosophila melanogaster CG30325-PA
           protein.
          Length = 750

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 15/27 (55%), Positives = 16/27 (59%)
 Frame = +2

Query: 95  KMVKKMEVTQHAKYTCSFCGKDAMKRS 175
           K VKK E +QH K TCS C     KRS
Sbjct: 657 KDVKK-EPSQHFKKTCSLCKCVRRKRS 682


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,500,455
Number of Sequences: 53049
Number of extensions: 304369
Number of successful extensions: 852
Number of sequences better than 10.0: 46
Number of HSP's better than 10.0 without gapping: 811
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 852
length of database: 24,988,368
effective HSP length: 72
effective length of database: 21,168,840
effective search space used: 486883320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).