SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0018
         (678 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF254373-1|AAK53539.1| 2497|Drosophila melanogaster DOMINO B pro...    32   0.83 
AY051813-1|AAK93237.1| 1095|Drosophila melanogaster LD32234p pro...    31   1.1  
AE013599-3190|AAM70872.2| 2497|Drosophila melanogaster CG9696-PE...    31   1.1  
AY089266-1|AAL90004.1|  263|Drosophila melanogaster AT06251p pro...    31   1.4  
AE014297-2113|AAF55253.1|  263|Drosophila melanogaster CG5478-PA...    31   1.4  
U34328-1|AAA80662.1|  128|Drosophila melanogaster cytochrome P45...    29   5.8  
BT003607-1|AAO39610.1|  379|Drosophila melanogaster GH19777p pro...    29   5.8  
AY058294-1|AAL13523.1|  327|Drosophila melanogaster GH05567p pro...    29   5.8  
AL009188-2|CAA15672.1|  556|Drosophila melanogaster EG:165H7.1,F...    29   5.8  
AE014298-32|AAF45503.1|  556|Drosophila melanogaster CG3972-PA p...    29   5.8  
AE014296-505|AAF47680.2|  643|Drosophila melanogaster CG12187-PA...    29   5.8  
AE014134-887|AAZ66448.1| 9606|Drosophila melanogaster CG33715-PE...    29   5.8  

>AF254373-1|AAK53539.1| 2497|Drosophila melanogaster DOMINO B protein.
          Length = 2497

 Score = 31.9 bits (69), Expect = 0.83
 Identities = 18/55 (32%), Positives = 28/55 (50%)
 Frame = +2

Query: 275  EETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRT 439
            E T ++S S P+RK     LP K +  +  N NI      IS  P+++ + +P T
Sbjct: 2418 ESTPKESQSEPRRKITQPKLPKKEETNNKSNSNIGTLHRWISKSPRVMLRSTPGT 2472


>AY051813-1|AAK93237.1| 1095|Drosophila melanogaster LD32234p protein.
          Length = 1095

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 18/55 (32%), Positives = 28/55 (50%)
 Frame = +2

Query: 275  EETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRT 439
            E T ++S S P+RK     LP K +  +  N NI      IS  P+++ + +P T
Sbjct: 1016 ESTPKESQSEPRRKITQPKLPKKEETNNKSNSNIGTLHRWISKSPRVMLRSTPVT 1070


>AE013599-3190|AAM70872.2| 2497|Drosophila melanogaster CG9696-PE,
            isoform E protein.
          Length = 2497

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 18/55 (32%), Positives = 28/55 (50%)
 Frame = +2

Query: 275  EETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRT 439
            E T ++S S P+RK     LP K +  +  N NI      IS  P+++ + +P T
Sbjct: 2418 ESTPKESQSEPRRKITQPKLPKKEETNNKSNSNIGTLHRWISKSPRVMLRSTPVT 2472


>AY089266-1|AAL90004.1|  263|Drosophila melanogaster AT06251p
           protein.
          Length = 263

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 6/83 (7%)
 Frame = +3

Query: 90  MISFKHFEKKLDKL-QDDVNDHGKTLG---DLKTMVSKLS--QNTVIGPESKLDDWRVPF 251
           MI   +++K  D+L ++ +ND  +T      ++   SK    QN +      +D W    
Sbjct: 1   MIQEPNWKKDYDRLVREHLNDQNQTKSLQRQIRHFRSKRVRLQNEIEAESRSMDVWVKMM 60

Query: 252 KRLHQYSTKKQKEIHALFPRERK 320
           + LH+   + QK  H L P++RK
Sbjct: 61  ENLHRGVERFQKHHHLLTPKKRK 83


>AE014297-2113|AAF55253.1|  263|Drosophila melanogaster CG5478-PA
           protein.
          Length = 263

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 6/83 (7%)
 Frame = +3

Query: 90  MISFKHFEKKLDKL-QDDVNDHGKTLG---DLKTMVSKLS--QNTVIGPESKLDDWRVPF 251
           MI   +++K  D+L ++ +ND  +T      ++   SK    QN +      +D W    
Sbjct: 1   MIQEPNWKKDYDRLVREHLNDQNQTKSLQRQIRHFRSKRVRLQNEIEAESRSMDVWVKMM 60

Query: 252 KRLHQYSTKKQKEIHALFPRERK 320
           + LH+   + QK  H L P++RK
Sbjct: 61  ENLHRGVERFQKHHHLLTPKKRK 83


>U34328-1|AAA80662.1|  128|Drosophila melanogaster cytochrome P450
           protein.
          Length = 128

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = -2

Query: 281 FLRTVLMQTLERYPPIVELAFRTDY 207
           +L  V+++TL  YPP+  +A R DY
Sbjct: 48  YLERVILETLRLYPPVPLIARRLDY 72


>BT003607-1|AAO39610.1|  379|Drosophila melanogaster GH19777p
           protein.
          Length = 379

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +2

Query: 359 LQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPTL 475
           LQN+  + A  P S+PP +     P    +E PR+  ++
Sbjct: 167 LQNRGALPAVPPSSIPPPMASFTGPNLEDLEAPRRQTSM 205


>AY058294-1|AAL13523.1|  327|Drosophila melanogaster GH05567p
           protein.
          Length = 327

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = -2

Query: 281 FLRTVLMQTLERYPPIVELAFRTDY 207
           +L  V+++TL  YPP+  +A R DY
Sbjct: 179 YLERVILETLRLYPPVPLIARRLDY 203


>AL009188-2|CAA15672.1|  556|Drosophila melanogaster
           EG:165H7.1,FBgn0011757;ASC-T1 protein.
          Length = 556

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = -2

Query: 281 FLRTVLMQTLERYPPIVELAFRTDY 207
           +L  V+++TL  YPP+  +A R DY
Sbjct: 408 YLERVILETLRLYPPVPLIARRLDY 432


>AE014298-32|AAF45503.1|  556|Drosophila melanogaster CG3972-PA
           protein.
          Length = 556

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = -2

Query: 281 FLRTVLMQTLERYPPIVELAFRTDY 207
           +L  V+++TL  YPP+  +A R DY
Sbjct: 408 YLERVILETLRLYPPVPLIARRLDY 432


>AE014296-505|AAF47680.2|  643|Drosophila melanogaster CG12187-PA
           protein.
          Length = 643

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +2

Query: 359 LQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPTL 475
           LQN+  + A  P S+PP +     P    +E PR+  ++
Sbjct: 431 LQNRGALPAVPPSSIPPPMASFTGPNLEDLEAPRRQTSM 469


>AE014134-887|AAZ66448.1| 9606|Drosophila melanogaster CG33715-PE,
            isoform E protein.
          Length = 9606

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%)
 Frame = +2

Query: 305  PKRKKNIQPLPIKSKAKSLQNQNIIEAAFPI--SVPPKIIRKRSPRTRKVETP 457
            P+ KK ++  P K KAK  +   ++EA  PI  S  P+ + + +     VE P
Sbjct: 5983 PEDKKPLEEKPKKQKAKKEKKTKVVEAPEPIVESAVPEAVVEPTVEVTFVEEP 6035



 Score = 28.7 bits (61), Expect = 7.7
 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%)
 Frame = +2

Query: 326  QPLPIKSK-AKSLQNQNIIEAAFPISVPPK 412
            +P P KSK +K     N++E+A  ISVP K
Sbjct: 1196 EPKPRKSKKSKKTTTDNVVESAVDISVPSK 1225


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,810,577
Number of Sequences: 53049
Number of extensions: 489608
Number of successful extensions: 1795
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1691
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1795
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2951284050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).