SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0015
         (598 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M20419-1|AAA28989.1|  447|Drosophila melanogaster protein ( D.me...   184   1e-46
BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p pro...   184   1e-46
AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA...   184   1e-46
AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB...   184   1e-46
M20420-1|AAA28991.1|  446|Drosophila melanogaster protein ( D.me...   177   7e-45
AY118725-1|AAM50585.1|  446|Drosophila melanogaster GH02051p pro...   177   7e-45
AE014297-930|AAF54373.1|  446|Drosophila melanogaster CG9359-PA ...   177   7e-45
AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p pro...   168   6e-42
AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA...   168   6e-42
X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubul...   163   1e-40
M22335-1|AAA28993.1|  454|Drosophila melanogaster protein ( D.me...   163   1e-40
BT015991-1|AAV36876.1|  454|Drosophila melanogaster RE53159p pro...   163   1e-40
AE013599-3851|AAF47193.2|  454|Drosophila melanogaster CG3401-PA...   163   1e-40
AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD...   130   2e-30
AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC...   130   2e-30
M14645-1|AAA28987.1|  450|Drosophila melanogaster protein ( D.me...   100   1e-21
M14643-1|AAA28985.1|  450|Drosophila melanogaster protein ( D.me...   100   1e-21
BT016118-1|AAV37003.1|  450|Drosophila melanogaster LD07757p pro...   100   1e-21
BT012506-1|AAS93777.1|  450|Drosophila melanogaster AT25469p pro...   100   1e-21
BT003630-1|AAO39634.1|  450|Drosophila melanogaster AT26363p pro...   100   1e-21
AY084208-1|AAL89946.1|  450|Drosophila melanogaster SD07763p pro...   100   1e-21
AE014297-627|AAN13341.1|  450|Drosophila melanogaster CG2512-PB,...   100   1e-21
AE014297-626|AAF54007.1|  450|Drosophila melanogaster CG2512-PA,...   100   1e-21
AE014297-554|AAF54067.1|  450|Drosophila melanogaster CG1913-PA ...   100   1e-21
M14644-1|AAA28986.1|  449|Drosophila melanogaster protein ( D.me...    99   5e-21
AY113631-1|AAM29636.1|  449|Drosophila melanogaster RH71862p pro...    99   5e-21
AE014297-1015|AAF54433.1|  449|Drosophila melanogaster CG9476-PA...    99   5e-21
BT011034-1|AAR30194.1|  240|Drosophila melanogaster RE44641p pro...    85   7e-17
M14646-1|AAA28988.1|  462|Drosophila melanogaster protein ( D.me...    82   6e-16
AE014296-1707|AAF50226.2|  462|Drosophila melanogaster CG8308-PA...    82   6e-16
AY089468-1|AAL90206.1|  462|Drosophila melanogaster AT27896p pro...    79   3e-15
AE014296-1121|AAF50659.1|  462|Drosophila melanogaster CG32396-P...    79   3e-15
M61765-1|AAA28597.1|  475|Drosophila melanogaster gamma-tubulin ...    77   2e-14
AY069633-1|AAL39778.1|  475|Drosophila melanogaster LD40196p pro...    77   2e-14
AF073994-1|AAC27620.1|  333|Drosophila melanogaster gamma-tubuli...    77   2e-14
AE014134-523|AAF51174.1|  475|Drosophila melanogaster CG3157-PA ...    77   2e-14
M76765-1|AAB52553.1|  457|Drosophila melanogaster gamma-tubulin ...    75   7e-14
AY070558-1|AAL48029.1|  457|Drosophila melanogaster LD32755p pro...    75   7e-14
AJ010552-1|CAA09233.1|  457|Drosophila melanogaster gamma-tubuli...    75   7e-14
AF091265-1|AAC64117.1|  457|Drosophila melanogaster gamma-tubuli...    75   7e-14
AF081253-1|AAC35844.1|  351|Drosophila melanogaster gamma-tubuli...    75   7e-14
AF081252-1|AAC35843.1|  457|Drosophila melanogaster gamma-tubuli...    75   7e-14
AE014134-3061|AAF53774.1|  457|Drosophila melanogaster CG17566-P...    75   7e-14
AY089253-1|AAL89991.1|  455|Drosophila melanogaster AT04270p pro...    67   1e-11
AE014297-2432|AAF55488.1|  455|Drosophila melanogaster CG7794-PA...    67   1e-11
S60740-1|AAD13917.1|   25|Drosophila melanogaster beta 3 tubulin...    48   7e-06
X16825-1|CAA34725.1|   19|Drosophila melanogaster protein ( Dros...    44   2e-04
BT011408-1|AAR96200.1| 1046|Drosophila melanogaster AT20689p pro...    34   0.17 
AE014297-3677|AAN14027.1| 1193|Drosophila melanogaster CG6238-PB...    34   0.17 
AE014297-3676|AAF56372.3| 1192|Drosophila melanogaster CG6238-PA...    34   0.17 
AB036834-1|BAA89534.1| 1045|Drosophila melanogaster MAP kinase p...    34   0.17 
AY095530-1|AAM12261.1| 1079|Drosophila melanogaster RE37107p pro...    29   4.8  
AE014296-2770|AAF49437.2| 1079|Drosophila melanogaster CG32164-P...    29   4.8  
AE014296-2768|AAG22314.2| 1080|Drosophila melanogaster CG32165-P...    29   4.8  
BT003322-1|AAO25082.1|  575|Drosophila melanogaster AT02511p pro...    28   8.4  
AY119214-1|AAM51074.1|  321|Drosophila melanogaster SD15982p pro...    28   8.4  
AE014297-1414|AAF54725.1|  321|Drosophila melanogaster CG18347-P...    28   8.4  
AE013599-3720|AAM68275.2|  489|Drosophila melanogaster CG11184-P...    28   8.4  
AE013599-2343|AAS64829.1|  575|Drosophila melanogaster CG15920-P...    28   8.4  
AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-P...    28   8.4  

>M20419-1|AAA28989.1|  447|Drosophila melanogaster protein (
           D.melanogaster beta-1 tubulin mRNA, complete cds. ).
          Length = 447

 Score =  184 bits (447), Expect = 1e-46
 Identities = 83/87 (95%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 96.3 bits (229), Expect = 3e-20
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWE+ISDEHGIDATG Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGTYHGDSDLQLE 45


>BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p
           protein.
          Length = 447

 Score =  184 bits (447), Expect = 1e-46
 Identities = 83/87 (95%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 97.9 bits (233), Expect = 9e-21
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWE+ISDEHGIDATGAY GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDLQLE 45


>AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA,
           isoform A protein.
          Length = 456

 Score =  184 bits (447), Expect = 1e-46
 Identities = 83/87 (95%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 56  INVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 115

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 116 TEGAELVDSVLDVVRKEAESCDCLQGF 142



 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 24/26 (92%), Positives = 25/26 (96%)
 Frame = +3

Query: 177 FWEVISDEHGIDATGAYSGDSDLQLE 254
           FWE+ISDEHGIDATGAY GDSDLQLE
Sbjct: 29  FWEIISDEHGIDATGAYHGDSDLQLE 54


>AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB,
           isoform B protein.
          Length = 447

 Score =  184 bits (447), Expect = 1e-46
 Identities = 83/87 (95%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 97.9 bits (233), Expect = 9e-21
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWE+ISDEHGIDATGAY GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDLQLE 45


>M20420-1|AAA28991.1|  446|Drosophila melanogaster protein (
           D.melanogaster beta-2 tubulin mRNA, complete cds. ).
          Length = 446

 Score =  177 bits (432), Expect = 7e-45
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSG FGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+EGCDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESEGCDCLQGF 133



 Score = 91.1 bits (216), Expect = 1e-18
 Identities = 41/45 (91%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIG KFWEVISDEH IDATG Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLE 45


>AY118725-1|AAM50585.1|  446|Drosophila melanogaster GH02051p
           protein.
          Length = 446

 Score =  177 bits (432), Expect = 7e-45
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSG FGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+EGCDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESEGCDCLQGF 133



 Score = 91.1 bits (216), Expect = 1e-18
 Identities = 41/45 (91%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIG KFWEVISDEH IDATG Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLE 45


>AE014297-930|AAF54373.1|  446|Drosophila melanogaster CG9359-PA
           protein.
          Length = 446

 Score =  177 bits (432), Expect = 7e-45
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSG FGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+EGCDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESEGCDCLQGF 133



 Score = 91.1 bits (216), Expect = 1e-18
 Identities = 41/45 (91%), Positives = 41/45 (91%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIG KFWEVISDEH IDATG Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLE 45


>AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p
           protein.
          Length = 457

 Score =  168 bits (408), Expect = 6e-42
 Identities = 72/87 (82%), Positives = 82/87 (94%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS GKYVPRAV++DLEPGTMDSVR  P GQ+FRPDNFV+GQSGAGNNWAKGHY
Sbjct: 47  IDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVL+V+RKE+EGCDCL+ F
Sbjct: 107 TEGAELIDSVLEVLRKESEGCDCLQGF 133



 Score = 81.8 bits (193), Expect = 6e-16
 Identities = 35/45 (77%), Positives = 39/45 (86%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIG+KFWE+ISDEHGID  G Y G+S LQ E
Sbjct: 1   MREIVHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESALQHE 45


>AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA
           protein.
          Length = 522

 Score =  168 bits (408), Expect = 6e-42
 Identities = 72/87 (82%), Positives = 82/87 (94%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS GKYVPRAV++DLEPGTMDSVR  P GQ+FRPDNFV+GQSGAGNNWAKGHY
Sbjct: 47  IDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+DSVL+V+RKE+EGCDCL+ F
Sbjct: 107 TEGAELIDSVLEVLRKESEGCDCLQGF 133



 Score = 81.8 bits (193), Expect = 6e-16
 Identities = 35/45 (77%), Positives = 39/45 (86%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIG+KFWE+ISDEHGID  G Y G+S LQ E
Sbjct: 1   MREIVHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESALQHE 45


>X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubulin
           protein.
          Length = 435

 Score =  163 bits (397), Expect = 1e-40
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 6/93 (6%)
 Frame = +2

Query: 257 INVYYNEAS------GGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN 418
           ++VYYNEAS      GGKYVPRA+++DLEPGTM+SVRSGP+GQ+FRPDNFV+GQSGAGNN
Sbjct: 28  VSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNN 87

Query: 419 WAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           WAKGHYTEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 88  WAKGHYTEGAELVDNVLDVVRKECENCDCLQGF 120



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 20/26 (76%), Positives = 23/26 (88%)
 Frame = +3

Query: 177 FWEVISDEHGIDATGAYSGDSDLQLE 254
           FWE+IS+EHGID+ G Y GDSDLQLE
Sbjct: 1   FWEIISEEHGIDSNGIYVGDSDLQLE 26


>M22335-1|AAA28993.1|  454|Drosophila melanogaster protein (
           D.melanogaster beta-3 tubulin gene, exons 2, 3 and 4. ).
          Length = 454

 Score =  163 bits (397), Expect = 1e-40
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 6/93 (6%)
 Frame = +2

Query: 257 INVYYNEAS------GGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN 418
           ++VYYNEAS      GGKYVPRA+++DLEPGTM+SVRSGP+GQ+FRPDNFV+GQSGAGNN
Sbjct: 47  VSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNN 106

Query: 419 WAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           WAKGHYTEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 107 WAKGHYTEGAELVDNVLDVVRKECENCDCLQGF 139



 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 38/45 (84%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWE+IS+EHGID+ G Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQLE 45


>BT015991-1|AAV36876.1|  454|Drosophila melanogaster RE53159p
           protein.
          Length = 454

 Score =  163 bits (397), Expect = 1e-40
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 6/93 (6%)
 Frame = +2

Query: 257 INVYYNEAS------GGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN 418
           ++VYYNEAS      GGKYVPRA+++DLEPGTM+SVRSGP+GQ+FRPDNFV+GQSGAGNN
Sbjct: 47  VSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNN 106

Query: 419 WAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           WAKGHYTEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 107 WAKGHYTEGAELVDNVLDVVRKECENCDCLQGF 139



 Score = 87.0 bits (206), Expect = 2e-17
 Identities = 37/45 (82%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIV++QAGQCGNQIGAKFWE+IS+EHGID+ G Y GDSDLQLE
Sbjct: 1   MREIVNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQLE 45


>AE013599-3851|AAF47193.2|  454|Drosophila melanogaster CG3401-PA
           protein.
          Length = 454

 Score =  163 bits (397), Expect = 1e-40
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 6/93 (6%)
 Frame = +2

Query: 257 INVYYNEAS------GGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN 418
           ++VYYNEAS      GGKYVPRA+++DLEPGTM+SVRSGP+GQ+FRPDNFV+GQSGAGNN
Sbjct: 47  VSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNN 106

Query: 419 WAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           WAKGHYTEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 107 WAKGHYTEGAELVDNVLDVVRKECENCDCLQGF 139



 Score = 87.0 bits (206), Expect = 2e-17
 Identities = 37/45 (82%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIV++QAGQCGNQIGAKFWE+IS+EHGID+ G Y GDSDLQLE
Sbjct: 1   MREIVNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQLE 45


>AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD,
           isoform D protein.
          Length = 375

 Score =  130 bits (313), Expect = 2e-30
 Identities = 58/61 (95%), Positives = 59/61 (96%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDCL+ 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC,
           isoform C protein.
          Length = 375

 Score =  130 bits (313), Expect = 2e-30
 Identities = 58/61 (95%), Positives = 59/61 (96%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDCL+ 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>M14645-1|AAA28987.1|  450|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-3), complete
           cds. ).
          Length = 450

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>M14643-1|AAA28985.1|  450|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-1), complete
           cds. ).
          Length = 450

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>BT016118-1|AAV37003.1|  450|Drosophila melanogaster LD07757p
           protein.
          Length = 450

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>BT012506-1|AAS93777.1|  450|Drosophila melanogaster AT25469p
           protein.
          Length = 450

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>BT003630-1|AAO39634.1|  450|Drosophila melanogaster AT26363p
           protein.
          Length = 450

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>AY084208-1|AAL89946.1|  450|Drosophila melanogaster SD07763p
           protein.
          Length = 450

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>AE014297-627|AAN13341.1|  450|Drosophila melanogaster CG2512-PB,
           isoform B protein.
          Length = 450

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>AE014297-626|AAF54007.1|  450|Drosophila melanogaster CG2512-PA,
           isoform A protein.
          Length = 450

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>AE014297-554|AAF54067.1|  450|Drosophila melanogaster CG1913-PA
           protein.
          Length = 450

 Score =  100 bits (240), Expect = 1e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADQCTGLQGF 135



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + I  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSD 39


>M14644-1|AAA28986.1|  449|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-2), complete
           cds. ).
          Length = 449

 Score = 98.7 bits (235), Expect = 5e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDVVLDRIRKLADQCTGLQGF 135



 Score = 37.1 bits (82), Expect = 0.018
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + +  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSD 39


>AY113631-1|AAM29636.1|  449|Drosophila melanogaster RH71862p
           protein.
          Length = 449

 Score = 98.7 bits (235), Expect = 5e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDVVLDRIRKLADQCTGLQGF 135



 Score = 37.1 bits (82), Expect = 0.018
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + +  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSD 39


>AE014297-1015|AAF54433.1|  449|Drosophila melanogaster CG9476-PA
           protein.
          Length = 449

 Score = 98.7 bits (235), Expect = 5e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDVVLDRIRKLADQCTGLQGF 135



 Score = 37.1 bits (82), Expect = 0.018
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 236
           MRE + +  GQ G QIG   WE+   EHGI   G    D
Sbjct: 1   MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSD 39


>BT011034-1|AAR30194.1|  240|Drosophila melanogaster RE44641p
           protein.
          Length = 240

 Score = 85.0 bits (201), Expect = 7e-17
 Identities = 35/84 (41%), Positives = 55/84 (65%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           ++ E   GK VPR++ VDLEP  +D VR+G  G+++ P+  + G+  A NN+A+G Y+ G
Sbjct: 63  FFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMGELYHPEQLISGKEDAANNYARGRYSIG 122

Query: 446 AELVDSVLDVVRKEAEGCDCLRVF 517
            E++D V   ++K AE CD L+ F
Sbjct: 123 KEVIDRVTSRLQKIAEQCDSLQGF 146



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 24/61 (39%), Positives = 34/61 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTITKLQGASTS 299
           MRE+V IQ GQCG QIG   WE+   EHGI+  G+     +L    S +++     A+ +
Sbjct: 1   MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDA 60

Query: 300 R 302
           R
Sbjct: 61  R 61


>M14646-1|AAA28988.1|  462|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-4), complete
           cds. ).
          Length = 462

 Score = 81.8 bits (193), Expect = 6e-16
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           ++ E   GK VPR++ VDLEP  +D VR+G   +++ P+  + G+  A NN+A+G Y+ G
Sbjct: 63  FFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIG 122

Query: 446 AELVDSVLDVVRKEAEGCDCLRVF 517
            E++D V   ++K AE CD L+ F
Sbjct: 123 KEVIDRVTSRLQKIAEQCDSLQGF 146



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 24/61 (39%), Positives = 34/61 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTITKLQGASTS 299
           MRE+V IQ GQCG QIG   WE+   EHGI+  G+     +L    S +++     A+ +
Sbjct: 1   MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDA 60

Query: 300 R 302
           R
Sbjct: 61  R 61


>AE014296-1707|AAF50226.2|  462|Drosophila melanogaster CG8308-PA
           protein.
          Length = 462

 Score = 81.8 bits (193), Expect = 6e-16
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           ++ E   GK VPR++ VDLEP  +D VR+G   +++ P+  + G+  A NN+A+G Y+ G
Sbjct: 63  FFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIG 122

Query: 446 AELVDSVLDVVRKEAEGCDCLRVF 517
            E++D V   ++K AE CD L+ F
Sbjct: 123 KEVIDRVTSRLQKIAEQCDSLQGF 146



 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 24/61 (39%), Positives = 34/61 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMSTITKLQGASTS 299
           MRE+V IQ GQCG QIG   WE+   EHGI+  G+     +L    S +++     A+ +
Sbjct: 1   MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDA 60

Query: 300 R 302
           R
Sbjct: 61  R 61


>AY089468-1|AAL90206.1|  462|Drosophila melanogaster AT27896p
           protein.
          Length = 462

 Score = 79.4 bits (187), Expect = 3e-15
 Identities = 33/87 (37%), Positives = 57/87 (65%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INV++N  +  ++  R +++D E  T+  + +    Q++RP+NFV G   AGNN+A+G++
Sbjct: 48  INVFFNATASKRFYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSESAGNNFARGYH 105

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           T+GA ++D VL+  R+E E  D L+ F
Sbjct: 106 TDGAAILDQVLENTRREVESVDSLQGF 132



 Score = 58.0 bits (134), Expect = 9e-09
 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGID-ATGAYSGDSDLQLE 254
           MREIV +Q G  GN IG  FW VIS EHG+D A+G + G S LQLE
Sbjct: 1   MREIVTLQIGGAGNAIGDSFWHVISHEHGVDYASGRFGGTSPLQLE 46


>AE014296-1121|AAF50659.1|  462|Drosophila melanogaster CG32396-PA
           protein.
          Length = 462

 Score = 79.4 bits (187), Expect = 3e-15
 Identities = 33/87 (37%), Positives = 57/87 (65%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INV++N  +  ++  R +++D E  T+  + +    Q++RP+NFV G   AGNN+A+G++
Sbjct: 48  INVFFNATASKRFYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSESAGNNFARGYH 105

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           T+GA ++D VL+  R+E E  D L+ F
Sbjct: 106 TDGAAILDQVLENTRREVESVDSLQGF 132



 Score = 58.0 bits (134), Expect = 9e-09
 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGID-ATGAYSGDSDLQLE 254
           MREIV +Q G  GN IG  FW VIS EHG+D A+G + G S LQLE
Sbjct: 1   MREIVTLQIGGAGNAIGDSFWHVISHEHGVDYASGRFGGTSPLQLE 46


>M61765-1|AAA28597.1|  475|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 475

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 32/88 (36%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++    + +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y++G +L + V D++ +EA+G D L  F
Sbjct: 108 YSQGEKLQEEVFDIIDREADGSDSLEGF 135



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI  +G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35


>AY069633-1|AAL39778.1|  475|Drosophila melanogaster LD40196p
           protein.
          Length = 475

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 32/88 (36%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++    + +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y++G +L + V D++ +EA+G D L  F
Sbjct: 108 YSQGEKLQEEVFDIIDREADGSDSLEGF 135



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI  +G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35


>AF073994-1|AAC27620.1|  333|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 333

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 32/88 (36%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++    + +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y++G +L + V D++ +EA+G D L  F
Sbjct: 108 YSQGEKLQEEVFDIIDREADGSDSLEGF 135



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI  +G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35


>AE014134-523|AAF51174.1|  475|Drosophila melanogaster CG3157-PA
           protein.
          Length = 475

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 32/88 (36%), Positives = 57/88 (64%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++    + +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y++G +L + V D++ +EA+G D L  F
Sbjct: 108 YSQGEKLQEEVFDIIDREADGSDSLEGF 135



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI  +G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35


>M76765-1|AAB52553.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 30/88 (34%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + V D++ +EA+G D L  F
Sbjct: 108 FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AY070558-1|AAL48029.1|  457|Drosophila melanogaster LD32755p
           protein.
          Length = 457

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 30/88 (34%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + V D++ +EA+G D L  F
Sbjct: 108 FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AJ010552-1|CAA09233.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 30/88 (34%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + V D++ +EA+G D L  F
Sbjct: 108 FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AF091265-1|AAC64117.1|  457|Drosophila melanogaster gamma-tubulin
           37CD protein.
          Length = 457

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 30/88 (34%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + V D++ +EA+G D L  F
Sbjct: 108 FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AF081253-1|AAC35844.1|  351|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 351

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 30/88 (34%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + V D++ +EA+G D L  F
Sbjct: 108 FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AF081252-1|AAC35843.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 30/88 (34%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + V D++ +EA+G D L  F
Sbjct: 108 FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AE014134-3061|AAF53774.1|  457|Drosophila melanogaster CG17566-PA
           protein.
          Length = 457

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 30/88 (34%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  ++++ + P+ +++  +N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + V D++ +EA+G D L  F
Sbjct: 108 FSQGEKVQEEVFDILDREADGSDSLEGF 135



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35


>AY089253-1|AAL89991.1|  455|Drosophila melanogaster AT04270p
           protein.
          Length = 455

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 27/73 (36%), Positives = 47/73 (64%)
 Frame = +2

Query: 299 PRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV 478
           PR VM+D EP  +D +R+G +  +F PD  + G+  +G+N+A+G+    +EL+D  ++ +
Sbjct: 63  PRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAI 122

Query: 479 RKEAEGCDCLRVF 517
           R+ A+ C  LR F
Sbjct: 123 RRVADRCRNLRGF 135



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ I  GQ G QI    WE+   EHGI A G
Sbjct: 6   EIIQIHIGQAGVQIANACWELFCLEHGILANG 37


>AE014297-2432|AAF55488.1|  455|Drosophila melanogaster CG7794-PA
           protein.
          Length = 455

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 27/73 (36%), Positives = 47/73 (64%)
 Frame = +2

Query: 299 PRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV 478
           PR VM+D EP  +D +R+G +  +F PD  + G+  +G+N+A+G+    +EL+D  ++ +
Sbjct: 63  PRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAI 122

Query: 479 RKEAEGCDCLRVF 517
           R+ A+ C  LR F
Sbjct: 123 RRVADRCRNLRGF 135



 Score = 33.9 bits (74), Expect = 0.17
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 126 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           EI+ I  GQ G QI    WE+   EHGI A G
Sbjct: 6   EIIQIHIGQAGVQIANACWELFCLEHGILANG 37


>S60740-1|AAD13917.1|   25|Drosophila melanogaster beta 3 tubulin
           protein.
          Length = 25

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +3

Query: 177 FWEVISDEHGIDATGAYSGDSDLQL 251
           FWE+IS+EHGID+ G Y GDSDLQL
Sbjct: 1   FWEIISEEHGIDSNGIYVGDSDLQL 25


>X16825-1|CAA34725.1|   19|Drosophila melanogaster protein (
           Drosophila melanogasterDNA for 60C beta tubulin gene
           making beta 3 tubulin isoform.).
          Length = 19

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/19 (94%), Positives = 19/19 (100%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAK 176
           MREIVH+QAGQCGNQIGAK
Sbjct: 1   MREIVHLQAGQCGNQIGAK 19


>BT011408-1|AAR96200.1| 1046|Drosophila melanogaster AT20689p
           protein.
          Length = 1046

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = -1

Query: 571 SKESPYQIQYLLPENELAENPQTIAAFCFFSNYIQYRINQFSPLCVMXFRPVIPRPRLSE 392
           +K+    ++ L PE  +AE P+ +      SN   Y + Q   L +    P+  R R+ +
Sbjct: 617 TKQQSQSMENLTPERSVAEEPKNMR--FPGSNGENYSVTQNQVLHIQKHTPLSVRTRIHD 674

Query: 391 DEVVRSEDLPKRP 353
            E  R++ LP++P
Sbjct: 675 LEAHRADQLPQQP 687


>AE014297-3677|AAN14027.1| 1193|Drosophila melanogaster CG6238-PB,
           isoform B protein.
          Length = 1193

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = -1

Query: 571 SKESPYQIQYLLPENELAENPQTIAAFCFFSNYIQYRINQFSPLCVMXFRPVIPRPRLSE 392
           +K+    ++ L PE  +AE P+ +      SN   Y + Q   L +    P+  R R+ +
Sbjct: 617 TKQQSQSMENLTPERSVAEEPKNMR--FPGSNGENYSVTQNQVLHIQKHTPLSVRTRIHD 674

Query: 391 DEVVRSEDLPKRP 353
            E  R++ LP++P
Sbjct: 675 LEAHRADQLPQQP 687


>AE014297-3676|AAF56372.3| 1192|Drosophila melanogaster CG6238-PA,
           isoform A protein.
          Length = 1192

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = -1

Query: 571 SKESPYQIQYLLPENELAENPQTIAAFCFFSNYIQYRINQFSPLCVMXFRPVIPRPRLSE 392
           +K+    ++ L PE  +AE P+ +      SN   Y + Q   L +    P+  R R+ +
Sbjct: 616 TKQQSQSMENLTPERSVAEEPKNMR--FPGSNGENYSVTQNQVLHIQKHTPLSVRTRIHD 673

Query: 391 DEVVRSEDLPKRP 353
            E  R++ LP++P
Sbjct: 674 LEAHRADQLPQQP 686


>AB036834-1|BAA89534.1| 1045|Drosophila melanogaster MAP kinase
           phosphatase protein.
          Length = 1045

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = -1

Query: 571 SKESPYQIQYLLPENELAENPQTIAAFCFFSNYIQYRINQFSPLCVMXFRPVIPRPRLSE 392
           +K+    ++ L PE  +AE P+ +      SN   Y + Q   L +    P+  R R+ +
Sbjct: 616 TKQQSQSMENLTPERSVAEEPKNMR--FPGSNGENYSVTQNQVLHIQKHTPLSVRTRIHD 673

Query: 391 DEVVRSEDLPKRP 353
            E  R++ LP++P
Sbjct: 674 LEAHRADQLPQQP 686


>AY095530-1|AAM12261.1| 1079|Drosophila melanogaster RE37107p
           protein.
          Length = 1079

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -3

Query: 476 LHPVPNQPVQPPLCNXLSPSYSPPQTVRRRS 384
           LH VP++ + PPL + L P+   P+ V RRS
Sbjct: 344 LHMVPDKFI-PPLLDLLEPALQSPEPVLRRS 373


>AE014296-2770|AAF49437.2| 1079|Drosophila melanogaster CG32164-PA
           protein.
          Length = 1079

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -3

Query: 476 LHPVPNQPVQPPLCNXLSPSYSPPQTVRRRS 384
           LH VP++ + PPL + L P+   P+ V RRS
Sbjct: 344 LHMVPDKFI-PPLLDLLEPALQSPEPVLRRS 373


>AE014296-2768|AAG22314.2| 1080|Drosophila melanogaster CG32165-PA
           protein.
          Length = 1080

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -3

Query: 476 LHPVPNQPVQPPLCNXLSPSYSPPQTVRRRS 384
           LH VP++ + PPL + L P+   P+ V RRS
Sbjct: 345 LHMVPDKFI-PPLLDLLEPALQSPEPVLRRS 374


>BT003322-1|AAO25082.1|  575|Drosophila melanogaster AT02511p
           protein.
          Length = 575

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +2

Query: 317 DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           D   G+  S   GP GQ    D +  G+ G GN    G Y+ G
Sbjct: 360 DANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGG 402


>AY119214-1|AAM51074.1|  321|Drosophila melanogaster SD15982p
           protein.
          Length = 321

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = -2

Query: 417 LFPAPDCPKTKLSGRKICPNGPERTESMVPGSRSTITARGTY 292
           +FP  D  KT+L  ++I PNG     SM    R T  A G +
Sbjct: 39  VFPL-DLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYF 79


>AE014297-1414|AAF54725.1|  321|Drosophila melanogaster CG18347-PA
           protein.
          Length = 321

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = -2

Query: 417 LFPAPDCPKTKLSGRKICPNGPERTESMVPGSRSTITARGTY 292
           +FP  D  KT+L  ++I PNG     SM    R T  A G +
Sbjct: 39  VFPL-DLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYF 79


>AE013599-3720|AAM68275.2|  489|Drosophila melanogaster CG11184-PC,
           isoform C protein.
          Length = 489

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = -3

Query: 422 PSYSP-PQTVRRRSCPVGRFAQTARNGRSPWFQ 327
           P  SP P+ V + SCP  + A+ AR  R PW++
Sbjct: 437 PFTSPKPEFVHQMSCPKVQAAKMARMERLPWWR 469


>AE013599-2343|AAS64829.1|  575|Drosophila melanogaster CG15920-PB,
           isoform B protein.
          Length = 575

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +2

Query: 317 DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           D   G+  S   GP GQ    D +  G+ G GN    G Y+ G
Sbjct: 360 DANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGG 402


>AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-PA,
           isoform A protein.
          Length = 620

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +2

Query: 317 DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           D   G+  S   GP GQ    D +  G+ G GN    G Y+ G
Sbjct: 405 DANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGG 447


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,499,654
Number of Sequences: 53049
Number of extensions: 634340
Number of successful extensions: 2074
Number of sequences better than 10.0: 60
Number of HSP's better than 10.0 without gapping: 1846
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2051
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2420893683
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).