SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0013
         (698 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY060845-1|AAL28393.1|  186|Drosophila melanogaster GM02242p pro...    59   5e-09
AE014298-945|AAN09183.1|  186|Drosophila melanogaster CG3203-PD,...    59   5e-09
AE014298-944|AAF46194.1|  186|Drosophila melanogaster CG3203-PC,...    59   5e-09
AE014298-943|AAN09182.1|  186|Drosophila melanogaster CG3203-PB,...    59   5e-09
AE014298-942|AAF46195.1|  186|Drosophila melanogaster CG3203-PA,...    59   5e-09
BT022716-1|AAY55132.1|  536|Drosophila melanogaster RE69201p pro...    30   3.5  
AE014134-951|AAF52276.2|  606|Drosophila melanogaster CG31646-PA...    30   3.5  

>AY060845-1|AAL28393.1|  186|Drosophila melanogaster GM02242p
           protein.
          Length = 186

 Score = 59.3 bits (137), Expect = 5e-09
 Identities = 26/33 (78%), Positives = 29/33 (87%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           N AKSCKARG NLRVHFKN +ETA AI++MPLR
Sbjct: 10  NVAKSCKARGPNLRVHFKNTHETAQAIKRMPLR 42



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/26 (69%), Positives = 21/26 (80%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           RYLK VID+KEC+PFRRF    +GRC
Sbjct: 46  RYLKAVIDQKECVPFRRFNG-GVGRC 70


>AE014298-945|AAN09183.1|  186|Drosophila melanogaster CG3203-PD,
           isoform D protein.
          Length = 186

 Score = 59.3 bits (137), Expect = 5e-09
 Identities = 26/33 (78%), Positives = 29/33 (87%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           N AKSCKARG NLRVHFKN +ETA AI++MPLR
Sbjct: 10  NVAKSCKARGPNLRVHFKNTHETAQAIKRMPLR 42



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/26 (69%), Positives = 21/26 (80%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           RYLK VID+KEC+PFRRF    +GRC
Sbjct: 46  RYLKAVIDQKECVPFRRFNG-GVGRC 70


>AE014298-944|AAF46194.1|  186|Drosophila melanogaster CG3203-PC,
           isoform C protein.
          Length = 186

 Score = 59.3 bits (137), Expect = 5e-09
 Identities = 26/33 (78%), Positives = 29/33 (87%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           N AKSCKARG NLRVHFKN +ETA AI++MPLR
Sbjct: 10  NVAKSCKARGPNLRVHFKNTHETAQAIKRMPLR 42



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/26 (69%), Positives = 21/26 (80%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           RYLK VID+KEC+PFRRF    +GRC
Sbjct: 46  RYLKAVIDQKECVPFRRFNG-GVGRC 70


>AE014298-943|AAN09182.1|  186|Drosophila melanogaster CG3203-PB,
           isoform B protein.
          Length = 186

 Score = 59.3 bits (137), Expect = 5e-09
 Identities = 26/33 (78%), Positives = 29/33 (87%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           N AKSCKARG NLRVHFKN +ETA AI++MPLR
Sbjct: 10  NVAKSCKARGPNLRVHFKNTHETAQAIKRMPLR 42



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/26 (69%), Positives = 21/26 (80%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           RYLK VID+KEC+PFRRF    +GRC
Sbjct: 46  RYLKAVIDQKECVPFRRFNG-GVGRC 70


>AE014298-942|AAF46195.1|  186|Drosophila melanogaster CG3203-PA,
           isoform A protein.
          Length = 186

 Score = 59.3 bits (137), Expect = 5e-09
 Identities = 26/33 (78%), Positives = 29/33 (87%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           N AKSCKARG NLRVHFKN +ETA AI++MPLR
Sbjct: 10  NVAKSCKARGPNLRVHFKNTHETAQAIKRMPLR 42



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/26 (69%), Positives = 21/26 (80%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           RYLK VID+KEC+PFRRF    +GRC
Sbjct: 46  RYLKAVIDQKECVPFRRFNG-GVGRC 70


>BT022716-1|AAY55132.1|  536|Drosophila melanogaster RE69201p
           protein.
          Length = 536

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 5/59 (8%)
 Frame = -2

Query: 331 NARSTSILVRGASLGNG-DSVTSNAHRVLIW----VWRLTDHLTTASNGSDSSSRGTEY 170
           N++  + L RG S   G D   S  + V +     +W   DH +++S+ S +SSRG ++
Sbjct: 391 NSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDH 449


>AE014134-951|AAF52276.2|  606|Drosophila melanogaster CG31646-PA
           protein.
          Length = 606

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 5/59 (8%)
 Frame = -2

Query: 331 NARSTSILVRGASLGNG-DSVTSNAHRVLIW----VWRLTDHLTTASNGSDSSSRGTEY 170
           N++  + L RG S   G D   S  + V +     +W   DH +++S+ S +SSRG ++
Sbjct: 470 NSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDH 528


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,704,397
Number of Sequences: 53049
Number of extensions: 609541
Number of successful extensions: 1872
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1720
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1867
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3067209849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).