SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY118693-1|AAM50553.1|  580|Drosophila melanogaster AT17959p pro...    31   1.6  
AE013599-2943|AAF57524.1|  580|Drosophila melanogaster CG15128-P...    31   1.6  
U31351-1|AAB97618.1|  810|Drosophila melanogaster protein ( Dros...    29   4.8  
AF044287-1|AAC01743.1|  810|Drosophila melanogaster delta adapti...    29   4.8  
AJ242938-1|CAB62168.1|  880|Drosophila melanogaster homeoprotein...    29   6.3  
AF181638-1|AAD55424.1|  880|Drosophila melanogaster BcDNA.GH0863...    29   6.3  
AE013599-217|AAM70823.1|  880|Drosophila melanogaster CG3268-PA ...    29   6.3  
BT011188-1|AAR88549.1| 1034|Drosophila melanogaster RE06749p pro...    28   8.4  
AF002164-1|AAC14585.1| 1034|Drosophila melanogaster AP-3 delta-a...    28   8.4  
AE014298-1950|AAF48307.2| 1034|Drosophila melanogaster CG10986-P...    28   8.4  

>AY118693-1|AAM50553.1|  580|Drosophila melanogaster AT17959p
           protein.
          Length = 580

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +3

Query: 300 EIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNL-DMLQIGNIVNIFSKLLYIQDC 476
           E K+   N + F + VQI+   K   +L +++     L D L I + +     +L+I++C
Sbjct: 481 ESKNCNSNLWKFLSVVQIV---KANAILHKLEQTKEALEDALPIAHFLKSSELILFIENC 537

Query: 477 GSCYTENAFQK 509
            +C TE++  K
Sbjct: 538 MACNTEDSINK 548


>AE013599-2943|AAF57524.1|  580|Drosophila melanogaster CG15128-PA
           protein.
          Length = 580

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +3

Query: 300 EIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNL-DMLQIGNIVNIFSKLLYIQDC 476
           E K+   N + F + VQI+   K   +L +++     L D L I + +     +L+I++C
Sbjct: 481 ESKNCNSNLWKFLSVVQIV---KANAILHKLEQTKEALEDALPIAHFLKSSELILFIENC 537

Query: 477 GSCYTENAFQK 509
            +C TE++  K
Sbjct: 538 MACNTEDSINK 548


>U31351-1|AAB97618.1|  810|Drosophila melanogaster protein (
           Drosophila melanogastergarnet mRNA, complete cds. ).
          Length = 810

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 8/66 (12%)
 Frame = +3

Query: 348 QIIDAKKGKNVLKRVQLPPLNLDMLQIGNIVNIFSKL----LYIQDCGSCYTENAFQ--- 506
           ++ DA+K  N+L R +L P ++  + + N++ +F++L    L +QD     T +A     
Sbjct: 428 ELEDAEKTLNILLRPRLLPGHIQGVYVQNVIKLFARLATTCLELQDLPGLVTVSALSIRI 487

Query: 507 -KCQVL 521
            KC +L
Sbjct: 488 FKCCIL 493


>AF044287-1|AAC01743.1|  810|Drosophila melanogaster delta adaptin
           subunit of AP-3 protein.
          Length = 810

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 8/66 (12%)
 Frame = +3

Query: 348 QIIDAKKGKNVLKRVQLPPLNLDMLQIGNIVNIFSKL----LYIQDCGSCYTENAFQ--- 506
           ++ DA+K  N+L R +L P ++  + + N++ +F++L    L +QD     T +A     
Sbjct: 428 ELEDAEKTLNILLRPRLLPGHIQGVYVQNVIKLFARLATTCLELQDLPGLVTVSALSIRI 487

Query: 507 -KCQVL 521
            KC +L
Sbjct: 488 FKCCIL 493


>AJ242938-1|CAB62168.1|  880|Drosophila melanogaster homeoprotein
           phtf protein.
          Length = 880

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = -3

Query: 404 WW*LYSFQNIFAFLRVYYLNRIVKWKI 324
           WW   +  N F F+ V YL ++  W I
Sbjct: 88  WWVKQTTPNAFGFILVLYLTQLTNWAI 114


>AF181638-1|AAD55424.1|  880|Drosophila melanogaster BcDNA.GH08636
           protein.
          Length = 880

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = -3

Query: 404 WW*LYSFQNIFAFLRVYYLNRIVKWKI 324
           WW   +  N F F+ V YL ++  W I
Sbjct: 88  WWVKQTTPNAFGFILVLYLTQLTNWAI 114


>AE013599-217|AAM70823.1|  880|Drosophila melanogaster CG3268-PA
           protein.
          Length = 880

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = -3

Query: 404 WW*LYSFQNIFAFLRVYYLNRIVKWKI 324
           WW   +  N F F+ V YL ++  W I
Sbjct: 88  WWVKQTTPNAFGFILVLYLTQLTNWAI 114


>BT011188-1|AAR88549.1| 1034|Drosophila melanogaster RE06749p
           protein.
          Length = 1034

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 11/37 (29%), Positives = 25/37 (67%)
 Frame = +3

Query: 348 QIIDAKKGKNVLKRVQLPPLNLDMLQIGNIVNIFSKL 458
           ++ DA+K  N+L R +L P ++  + + N++ +F++L
Sbjct: 494 ELEDAEKTLNILLRPRLLPGHIQGVYVQNVIKLFARL 530


>AF002164-1|AAC14585.1| 1034|Drosophila melanogaster AP-3
           delta-adaptin subunit protein.
          Length = 1034

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 11/37 (29%), Positives = 25/37 (67%)
 Frame = +3

Query: 348 QIIDAKKGKNVLKRVQLPPLNLDMLQIGNIVNIFSKL 458
           ++ DA+K  N+L R +L P ++  + + N++ +F++L
Sbjct: 494 ELEDAEKTLNILLRPRLLPGHIQGVYVQNVIKLFARL 530


>AE014298-1950|AAF48307.2| 1034|Drosophila melanogaster CG10986-PB
           protein.
          Length = 1034

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 11/37 (29%), Positives = 25/37 (67%)
 Frame = +3

Query: 348 QIIDAKKGKNVLKRVQLPPLNLDMLQIGNIVNIFSKL 458
           ++ DA+K  N+L R +L P ++  + + N++ +F++L
Sbjct: 494 ELEDAEKTLNILLRPRLLPGHIQGVYVQNVIKLFARL 530


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,876,604
Number of Sequences: 53049
Number of extensions: 433345
Number of successful extensions: 1178
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1138
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1177
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2420893683
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).