SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0008
         (698 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY075214-1|AAL68081.1|  520|Drosophila melanogaster AT15281p pro...    31   1.1  
AF384215-1|AAL40920.1|  520|Drosophila melanogaster adenosine de...    31   1.1  
AE014296-2953|AAF49307.1|  520|Drosophila melanogaster CG5998-PA...    31   1.1  
Y15606-1|CAA75690.1|  552|Drosophila melanogaster hormone recept...    30   2.6  
X89246-1|CAA61534.1|  551|Drosophila melanogaster DHR38 protein.       30   2.6  
U36762-1|AAC46926.1|  546|Drosophila melanogaster DHR38 protein.       30   2.6  
AJ002073-1|CAA05172.1| 1073|Drosophila melanogaster hormone rece...    30   2.6  
AE014134-3271|AAN11085.1|  556|Drosophila melanogaster CG1864-PC...    30   2.6  
AE014134-3270|AAF53914.1| 1078|Drosophila melanogaster CG1864-PB...    30   2.6  
BT021307-1|AAX33455.1|  118|Drosophila melanogaster RE17110p pro...    29   4.6  
AE014296-2016|AAF50020.1|   91|Drosophila melanogaster CG14132-P...    29   4.6  

>AY075214-1|AAL68081.1|  520|Drosophila melanogaster AT15281p
           protein.
          Length = 520

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 4/42 (9%)
 Frame = +1

Query: 100 LPALSAEDVSYQACVDKYSRKGYQPWQE----WSDHYTCHRY 213
           L +L+   + Y A V +  R GY+ WQE    W D    H+Y
Sbjct: 478 LKSLAINSIRYSALVGEEKRVGYRKWQEKWDKWIDDVVEHKY 519


>AF384215-1|AAL40920.1|  520|Drosophila melanogaster adenosine
           deaminase-related growthfactor B protein.
          Length = 520

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 4/42 (9%)
 Frame = +1

Query: 100 LPALSAEDVSYQACVDKYSRKGYQPWQE----WSDHYTCHRY 213
           L +L+   + Y A V +  R GY+ WQE    W D    H+Y
Sbjct: 478 LKSLAINSIRYSALVGEEKRVGYRKWQEKWDKWIDDVVEHKY 519


>AE014296-2953|AAF49307.1|  520|Drosophila melanogaster CG5998-PA
           protein.
          Length = 520

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 4/42 (9%)
 Frame = +1

Query: 100 LPALSAEDVSYQACVDKYSRKGYQPWQE----WSDHYTCHRY 213
           L +L+   + Y A V +  R GY+ WQE    W D    H+Y
Sbjct: 478 LKSLAINSIRYSALVGEEKRVGYRKWQEKWDKWIDDVVEHKY 519


>Y15606-1|CAA75690.1|  552|Drosophila melanogaster hormone receptor
           38 protein.
          Length = 552

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 339 CARLRCVVEVNGERIVQT---RGQPGELFPDKPWKGQQNEPNPAVVGMSGIQQTPVGGEP 509
           C   +C+V    + +V+T   +G+ G L P KP   Q++ P+P +  ++ + ++ V   P
Sbjct: 278 CRFQKCLVVGMVKEVVRTDSLKGRRGRL-PSKPKSPQESPPSPPISLITALVRSHVDTTP 336

Query: 510 RVRRLLEYLTAEEQRMA 560
                L+Y   EEQ M+
Sbjct: 337 D-PSCLDYSHYEEQSMS 352


>X89246-1|CAA61534.1|  551|Drosophila melanogaster DHR38 protein.
          Length = 551

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 339 CARLRCVVEVNGERIVQT---RGQPGELFPDKPWKGQQNEPNPAVVGMSGIQQTPVGGEP 509
           C   +C+V    + +V+T   +G+ G L P KP   Q++ P+P +  ++ + ++ V   P
Sbjct: 277 CRFQKCLVVGMVKEVVRTDSLKGRRGRL-PSKPKSPQESPPSPPISLITALVRSHVDTTP 335

Query: 510 RVRRLLEYLTAEEQRMA 560
                L+Y   EEQ M+
Sbjct: 336 D-PSCLDYSHYEEQSMS 351


>U36762-1|AAC46926.1|  546|Drosophila melanogaster DHR38 protein.
          Length = 546

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 339 CARLRCVVEVNGERIVQT---RGQPGELFPDKPWKGQQNEPNPAVVGMSGIQQTPVGGEP 509
           C   +C+V    + +V+T   +G+ G L P KP   Q++ P+P +  ++ + ++ V   P
Sbjct: 272 CRFQKCLVVGMVKEVVRTDSLKGRRGRL-PSKPKSPQESPPSPPISLITALVRSHVDTTP 330

Query: 510 RVRRLLEYLTAEEQRMA 560
                L+Y   EEQ M+
Sbjct: 331 D-PSCLDYSHYEEQSMS 346


>AJ002073-1|CAA05172.1| 1073|Drosophila melanogaster hormone receptor
            38 protein.
          Length = 1073

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 339  CARLRCVVEVNGERIVQT---RGQPGELFPDKPWKGQQNEPNPAVVGMSGIQQTPVGGEP 509
            C   +C+V    + +V+T   +G+ G L P KP   Q++ P+P +  ++ + ++ V   P
Sbjct: 799  CRFQKCLVVGMVKEVVRTDSLKGRRGRL-PSKPKSPQESPPSPPISLITALVRSHVDTTP 857

Query: 510  RVRRLLEYLTAEEQRMA 560
                 L+Y   EEQ M+
Sbjct: 858  D-PSCLDYSHYEEQSMS 873


>AE014134-3271|AAN11085.1|  556|Drosophila melanogaster CG1864-PC,
           isoform C protein.
          Length = 556

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 339 CARLRCVVEVNGERIVQT---RGQPGELFPDKPWKGQQNEPNPAVVGMSGIQQTPVGGEP 509
           C   +C+V    + +V+T   +G+ G L P KP   Q++ P+P +  ++ + ++ V   P
Sbjct: 282 CRFQKCLVVGMVKEVVRTDSLKGRRGRL-PSKPKSPQESPPSPPISLITALVRSHVDTTP 340

Query: 510 RVRRLLEYLTAEEQRMA 560
                L+Y   EEQ M+
Sbjct: 341 D-PSCLDYSHYEEQSMS 356


>AE014134-3270|AAF53914.1| 1078|Drosophila melanogaster CG1864-PB,
            isoform B protein.
          Length = 1078

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 339  CARLRCVVEVNGERIVQT---RGQPGELFPDKPWKGQQNEPNPAVVGMSGIQQTPVGGEP 509
            C   +C+V    + +V+T   +G+ G L P KP   Q++ P+P +  ++ + ++ V   P
Sbjct: 804  CRFQKCLVVGMVKEVVRTDSLKGRRGRL-PSKPKSPQESPPSPPISLITALVRSHVDTTP 862

Query: 510  RVRRLLEYLTAEEQRMA 560
                 L+Y   EEQ M+
Sbjct: 863  D-PSCLDYSHYEEQSMS 878


>BT021307-1|AAX33455.1|  118|Drosophila melanogaster RE17110p
           protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = +3

Query: 294 CHEYIEDENVEFPTCCARLRCV 359
           C E   D N  FP CC + +CV
Sbjct: 85  CEELPSDPNWRFPKCCPQFKCV 106


>AE014296-2016|AAF50020.1|   91|Drosophila melanogaster CG14132-PA
           protein.
          Length = 91

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = +3

Query: 294 CHEYIEDENVEFPTCCARLRCV 359
           C E   D N  FP CC + +CV
Sbjct: 58  CEELPSDPNWRFPKCCPQFKCV 79


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,744,614
Number of Sequences: 53049
Number of extensions: 800478
Number of successful extensions: 2261
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 2130
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2258
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3067209849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).