SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X81194-1|CAA57066.1|  436|Drosophila melanogaster TIScc1 protein.     108   6e-24
U13397-1|AAA62666.1|  437|Drosophila melanogaster DTIS11 protein...   108   6e-24
AE014298-1801|AAN09314.1|  408|Drosophila melanogaster CG4070-PB...   108   6e-24
AE014298-1800|AAF48194.2|  436|Drosophila melanogaster CG4070-PA...   108   6e-24
BT021949-1|AAX51654.1|  819|Drosophila melanogaster LD12033p pro...    40   0.004
AE014296-2720|AAF49474.1|  819|Drosophila melanogaster CG16807-P...    40   0.004
AY119481-1|AAM50135.1| 1288|Drosophila melanogaster GH07148p pro...    33   0.37 
AM294270-1|CAL26174.1|  357|Drosophila melanogaster CG4973 protein.    33   0.37 
AE014298-1522|AAF47973.2| 1288|Drosophila melanogaster CG1582-PA...    33   0.37 
AY122095-1|AAM52607.1|  557|Drosophila melanogaster GH05406p pro...    33   0.49 
AY051847-1|AAK93271.1|  357|Drosophila melanogaster LD35003p pro...    33   0.49 
AM294271-1|CAL26175.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AM294269-1|CAL26173.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AM294268-1|CAL26172.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AM294267-1|CAL26171.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AM294266-1|CAL26170.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AM294265-1|CAL26169.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AM294264-1|CAL26168.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AM294263-1|CAL26167.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AM294262-1|CAL26166.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AM294261-1|CAL26165.1|  357|Drosophila melanogaster CG4973 protein.    33   0.49 
AE014298-2224|AAF48515.1|  557|Drosophila melanogaster CG8470-PA...    33   0.49 
AE014297-2762|AAF55742.1|  357|Drosophila melanogaster CG4973-PA...    33   0.49 
Z11527-1|CAA77616.1|  614|Drosophila melanogaster CYS3HIS finger...    32   0.65 
BT021256-1|AAX33404.1|  608|Drosophila melanogaster RE58038p pro...    32   0.65 
AY051832-1|AAK93256.1|  484|Drosophila melanogaster LD33756p pro...    32   0.65 
AE014297-3282|AAO41594.1|  599|Drosophila melanogaster CG4620-PB...    32   0.65 
AE014297-3281|AAO41593.1|  599|Drosophila melanogaster CG4620-PA...    32   0.65 
BT023518-1|AAY84918.1|  275|Drosophila melanogaster IP10023p pro...    31   2.0  
BT023515-1|AAY84915.1|  251|Drosophila melanogaster IP10123p pro...    31   2.0  
BT029412-1|ABK57069.1|  320|Drosophila melanogaster IP02511p pro...    30   3.5  
BT025009-1|ABE01239.1|  296|Drosophila melanogaster IP02509p pro...    30   3.5  
AE014134-157|AAF51453.1|  296|Drosophila melanogaster CG3642-PA ...    30   3.5  
AY070561-1|AAL48032.1|  538|Drosophila melanogaster LD37523p pro...    29   4.6  
AE014297-149|AAF52095.1|  538|Drosophila melanogaster CG2503-PA ...    29   4.6  
Y16899-1|CAA76529.1|  712|Drosophila melanogaster optomotor-blin...    29   6.1  
AE014298-1177|AAF46373.1|  699|Drosophila melanogaster CG11202-P...    29   6.1  

>X81194-1|CAA57066.1|  436|Drosophila melanogaster TIScc1 protein.
          Length = 436

 Score =  108 bits (260), Expect = 6e-24
 Identities = 43/52 (82%), Positives = 47/52 (90%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           CQFAHG  ELRN+ RHPKYKTE CRTFHSVGFCPYGPRCHFVHNA+EAR ++
Sbjct: 156 CQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQ 207



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H + E R
Sbjct: 135 RYKTELCRPFEEAGECKYGEKCQFAHGSHELR 166



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/27 (66%), Positives = 19/27 (70%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTAS 277
           YKTELCRPFEEAG CKYG+       S
Sbjct: 136 YKTELCRPFEEAGECKYGEKCQFAHGS 162



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTE CR F   G C YG   + +
Sbjct: 174 YKTEYCRTFHSVGFCPYGPRCHFV 197


>U13397-1|AAA62666.1|  437|Drosophila melanogaster DTIS11 protein
           protein.
          Length = 437

 Score =  108 bits (260), Expect = 6e-24
 Identities = 43/52 (82%), Positives = 47/52 (90%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           CQFAHG  ELRN+ RHPKYKTE CRTFHSVGFCPYGPRCHFVHNA+EAR ++
Sbjct: 157 CQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQ 208



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H + E R
Sbjct: 136 RYKTELCRPFEEAGECKYGEKCQFAHGSHELR 167



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/27 (66%), Positives = 19/27 (70%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTAS 277
           YKTELCRPFEEAG CKYG+       S
Sbjct: 137 YKTELCRPFEEAGECKYGEKCQFAHGS 163



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTE CR F   G C YG   + +
Sbjct: 175 YKTEYCRTFHSVGFCPYGPRCHFV 198


>AE014298-1801|AAN09314.1|  408|Drosophila melanogaster CG4070-PB,
           isoform B protein.
          Length = 408

 Score =  108 bits (260), Expect = 6e-24
 Identities = 43/52 (82%), Positives = 47/52 (90%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           CQFAHG  ELRN+ RHPKYKTE CRTFHSVGFCPYGPRCHFVHNA+EAR ++
Sbjct: 128 CQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQ 179



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H + E R
Sbjct: 107 RYKTELCRPFEEAGECKYGEKCQFAHGSHELR 138



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/27 (66%), Positives = 19/27 (70%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTAS 277
           YKTELCRPFEEAG CKYG+       S
Sbjct: 108 YKTELCRPFEEAGECKYGEKCQFAHGS 134



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTE CR F   G C YG   + +
Sbjct: 146 YKTEYCRTFHSVGFCPYGPRCHFV 169


>AE014298-1800|AAF48194.2|  436|Drosophila melanogaster CG4070-PA,
           isoform A protein.
          Length = 436

 Score =  108 bits (260), Expect = 6e-24
 Identities = 43/52 (82%), Positives = 47/52 (90%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARRRE 411
           CQFAHG  ELRN+ RHPKYKTE CRTFHSVGFCPYGPRCHFVHNA+EAR ++
Sbjct: 156 CQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQ 207



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H + E R
Sbjct: 135 RYKTELCRPFEEAGECKYGEKCQFAHGSHELR 166



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 18/27 (66%), Positives = 19/27 (70%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTAS 277
           YKTELCRPFEEAG CKYG+       S
Sbjct: 136 YKTELCRPFEEAGECKYGEKCQFAHGS 162



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTE CR F   G C YG   + +
Sbjct: 174 YKTEYCRTFHSVGFCPYGPRCHFV 197


>BT021949-1|AAX51654.1|  819|Drosophila melanogaster LD12033p
           protein.
          Length = 819

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/35 (45%), Positives = 19/35 (54%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +PKYK  LCR  +    CP G  C F H+ EE  R
Sbjct: 415 NPKYKISLCRDLNVRRVCPRGSSCTFAHSQEEVER 449


>AE014296-2720|AAF49474.1|  819|Drosophila melanogaster CG16807-PA
           protein.
          Length = 819

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/35 (45%), Positives = 19/35 (54%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +PKYK  LCR  +    CP G  C F H+ EE  R
Sbjct: 415 NPKYKISLCRDLNVRRVCPRGSSCTFAHSQEEVER 449


>AY119481-1|AAM50135.1| 1288|Drosophila melanogaster GH07148p
           protein.
          Length = 1288

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVH 384
           CR F   G C YGP+C F H
Sbjct: 251 CRNFDRDGTCKYGPKCRFAH 270


>AM294270-1|CAL26174.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYQETGYCGFGDSCKFLHDRSD 223



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYQETGYCGFGDSCKFLHDRSDY 224


>AE014298-1522|AAF47973.2| 1288|Drosophila melanogaster CG1582-PA
           protein.
          Length = 1288

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVH 384
           CR F   G C YGP+C F H
Sbjct: 251 CRNFDRDGTCKYGPKCRFAH 270


>AY122095-1|AAM52607.1|  557|Drosophila melanogaster GH05406p
           protein.
          Length = 557

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = +3

Query: 147 SNAPPVNRLL-RHQPQVATRPSSADRLKKRGFVNMGIMPICSRRPR 281
           +NAP + R +   QP VA+  S+ +  ++R F+N     + S RPR
Sbjct: 442 ANAPSIQRSIGEQQPYVASDVSAYENAEQRDFINKTFKYLASNRPR 487


>AY051847-1|AAK93271.1|  357|Drosophila melanogaster LD35003p
           protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294271-1|CAL26175.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294269-1|CAL26173.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294268-1|CAL26172.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294267-1|CAL26171.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294266-1|CAL26170.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294265-1|CAL26169.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294264-1|CAL26168.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294263-1|CAL26167.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294262-1|CAL26166.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AM294261-1|CAL26165.1|  357|Drosophila melanogaster CG4973 protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>AE014298-2224|AAF48515.1|  557|Drosophila melanogaster CG8470-PA
           protein.
          Length = 557

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = +3

Query: 147 SNAPPVNRLL-RHQPQVATRPSSADRLKKRGFVNMGIMPICSRRPR 281
           +NAP + R +   QP VA+  S+ +  ++R F+N     + S RPR
Sbjct: 442 ANAPSIQRSIGEQQPYVASDVSAYENAEQRDFINKTFKYLASNRPR 487


>AE014297-2762|AAF55742.1|  357|Drosophila melanogaster CG4973-PA
           protein.
          Length = 357

 Score = 32.7 bits (71), Expect = 0.49
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSD 223



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 195 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 224


>Z11527-1|CAA77616.1|  614|Drosophila melanogaster CYS3HIS finger
           protein protein.
          Length = 614

 Score = 32.3 bits (70), Expect = 0.65
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G+CP    C F H
Sbjct: 272 CQYCHTRTEQ---QFHPEIYKSTKCNDVQQAGYCPRSVFCAFAH 312


>BT021256-1|AAX33404.1|  608|Drosophila melanogaster RE58038p
           protein.
          Length = 608

 Score = 32.3 bits (70), Expect = 0.65
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G+CP    C F H
Sbjct: 266 CQYCHTRTEQ---QFHPEIYKSTKCNDVQQAGYCPRSVFCAFAH 306


>AY051832-1|AAK93256.1|  484|Drosophila melanogaster LD33756p
           protein.
          Length = 484

 Score = 32.3 bits (70), Expect = 0.65
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G+CP    C F H
Sbjct: 142 CQYCHTRTEQ---QFHPEIYKSTKCNDVQQAGYCPRSVFCAFAH 182


>AE014297-3282|AAO41594.1|  599|Drosophila melanogaster CG4620-PB,
           isoform B protein.
          Length = 599

 Score = 32.3 bits (70), Expect = 0.65
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G+CP    C F H
Sbjct: 257 CQYCHTRTEQ---QFHPEIYKSTKCNDVQQAGYCPRSVFCAFAH 297


>AE014297-3281|AAO41593.1|  599|Drosophila melanogaster CG4620-PA,
           isoform A protein.
          Length = 599

 Score = 32.3 bits (70), Expect = 0.65
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G+CP    C F H
Sbjct: 257 CQYCHTRTEQ---QFHPEIYKSTKCNDVQQAGYCPRSVFCAFAH 297


>BT023518-1|AAY84918.1|  275|Drosophila melanogaster IP10023p
           protein.
          Length = 275

 Score = 30.7 bits (66), Expect = 2.0
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = -1

Query: 677 LVHRTKR*TRSPRADEKSVKNGQSVVFRIGGVRAAKSESC 558
           L++R K   + P    K++++G   + R GGV  +KSE C
Sbjct: 202 LIYRLKAKRQQP---SKTIESGDDFILRQGGVNTSKSEGC 238


>BT023515-1|AAY84915.1|  251|Drosophila melanogaster IP10123p
           protein.
          Length = 251

 Score = 30.7 bits (66), Expect = 2.0
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = -1

Query: 677 LVHRTKR*TRSPRADEKSVKNGQSVVFRIGGVRAAKSESC 558
           L++R K   + P    K++++G   + R GGV  +KSE C
Sbjct: 202 LIYRLKAKRQQP---SKTIESGDDFILRQGGVNTSKSEGC 238


>BT029412-1|ABK57069.1|  320|Drosophila melanogaster IP02511p
           protein.
          Length = 320

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           RH   +  LC  + + GFCP GP C  +H
Sbjct: 165 RHQHLRRVLCMDYLA-GFCPEGPSCKHMH 192


>BT025009-1|ABE01239.1|  296|Drosophila melanogaster IP02509p
           protein.
          Length = 296

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           RH   +  LC  + + GFCP GP C  +H
Sbjct: 141 RHQHLRRVLCMDYLA-GFCPEGPSCKHMH 168


>AE014134-157|AAF51453.1|  296|Drosophila melanogaster CG3642-PA
           protein.
          Length = 296

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           RH   +  LC  + + GFCP GP C  +H
Sbjct: 141 RHQHLRRVLCMDYLA-GFCPEGPSCKHMH 168


>AY070561-1|AAL48032.1|  538|Drosophila melanogaster LD37523p
           protein.
          Length = 538

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = -2

Query: 652 RDRREPMKSRLKTGSRSSSGSGEFVRRKAKA 560
           RDR+   +SR ++GS S SGSG   R  +++
Sbjct: 419 RDRQSRSRSRTRSGSSSGSGSGSGSRASSRS 449


>AE014297-149|AAF52095.1|  538|Drosophila melanogaster CG2503-PA
           protein.
          Length = 538

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = -2

Query: 652 RDRREPMKSRLKTGSRSSSGSGEFVRRKAKA 560
           RDR+   +SR ++GS S SGSG   R  +++
Sbjct: 419 RDRQSRSRSRTRSGSSSGSGSGSGSRASSRS 449


>Y16899-1|CAA76529.1|  712|Drosophila melanogaster
           optomotor-blind-related gene-1 protein.
          Length = 712

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = +3

Query: 492 ATLAAFPLTPHSPPAMSPPAQATAFAFRRT 581
           A + + PLTPHS  + SPPA A   A   T
Sbjct: 545 AQVQSHPLTPHSSSSASPPATAAPGASAAT 574


>AE014298-1177|AAF46373.1|  699|Drosophila melanogaster CG11202-PA
           protein.
          Length = 699

 Score = 29.1 bits (62), Expect = 6.1
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = +3

Query: 492 ATLAAFPLTPHSPPAMSPPAQATAFAFRRT 581
           A + + PLTPHS  + SPPA A   A   T
Sbjct: 543 AQVQSHPLTPHSSSSASPPATAAPGASAAT 572


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,850,854
Number of Sequences: 53049
Number of extensions: 638967
Number of successful extensions: 2926
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 2607
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2917
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3067209849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).