SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY060767-1|AAL28315.1|  215|Drosophila melanogaster GH22994p pro...   130   2e-30
AE014297-1587|AAF54868.2|  215|Drosophila melanogaster CG10126-P...   130   2e-30
AE014297-1586|AAO41493.2|  227|Drosophila melanogaster CG10126-P...   130   2e-30
AE014297-1584|AAF54865.2|  213|Drosophila melanogaster CG31345-P...   119   3e-27
AY122181-1|AAM52693.1| 1140|Drosophila melanogaster LD39385p pro...    43   4e-04
AF200425-1|AAF24343.1| 5201|Drosophila melanogaster Short stop/K...    43   4e-04
AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-P...    43   4e-04
AE013599-1791|AAM68562.1| 5160|Drosophila melanogaster CG18076-P...    43   4e-04
AE013599-1790|AAF58319.3| 5501|Drosophila melanogaster CG18076-P...    43   4e-04
AE013599-1789|AAM68561.1| 5201|Drosophila melanogaster CG18076-P...    43   4e-04
AE013599-1788|AAG22268.2| 5390|Drosophila melanogaster CG18076-P...    43   4e-04
AE013599-1787|AAF58317.1| 5385|Drosophila melanogaster CG18076-P...    43   4e-04
AY071434-1|AAL49056.1|  387|Drosophila melanogaster RE52086p pro...    40   0.002
AL109630-13|CAB51683.1|  426|Drosophila melanogaster EG:BACR7A4....    40   0.002
AE014298-139|AAF45577.3|  387|Drosophila melanogaster CG11638-PA...    40   0.002
BT003594-1|AAO39597.1|  533|Drosophila melanogaster HL01250p pro...    40   0.003
AE014298-1344|ABI30972.1|  533|Drosophila melanogaster CG32699-P...    40   0.003
AE014134-675|AAN10361.1|  148|Drosophila melanogaster CG31960-PA...    40   0.003
AY122132-1|AAM52644.1|  520|Drosophila melanogaster GH25190p pro...    38   0.014
AE014296-2136|AAF49921.2|  583|Drosophila melanogaster CG32103-P...    38   0.014
AE014296-2135|AAS65015.1|  583|Drosophila melanogaster CG32103-P...    38   0.014
BT003768-1|AAO41447.1|  170|Drosophila melanogaster RE27048p pro...    35   0.073
AY089602-1|AAL90340.1|  170|Drosophila melanogaster RE19603p pro...    35   0.073
AE013599-496|AAF59195.2|  170|Drosophila melanogaster CG11217-PA...    35   0.073
M97215-1|AAA28411.1|  170|Drosophila melanogaster calcineurin B ...    35   0.096
AY070642-1|AAL48113.1|  170|Drosophila melanogaster RH02643p pro...    35   0.096
AE014298-728|AAF46026.1|  170|Drosophila melanogaster CG4209-PA ...    35   0.096
BT003178-1|AAO24933.1|  476|Drosophila melanogaster RH09265p pro...    34   0.13 
BT001616-1|AAN71371.1|  155|Drosophila melanogaster RE34610p pro...    34   0.17 
Y00133-1|CAA68327.1|  148|Drosophila melanogaster protein ( Dros...    33   0.22 
X76042-1|CAA53627.1|  155|Drosophila melanogaster troponin-C pro...    33   0.22 
BT003282-1|AAO25039.1|  149|Drosophila melanogaster LD02334p pro...    33   0.22 
AY118890-1|AAM50750.1|  149|Drosophila melanogaster LD01127p pro...    33   0.22 
AE013599-1432|AAF58543.1|  149|Drosophila melanogaster CG8472-PB...    33   0.22 
AE013599-1431|AAF58542.1|  149|Drosophila melanogaster CG8472-PA...    33   0.22 
U15735-1|AAA62152.1|  190|Drosophila melanogaster DrosNCa protein.     33   0.29 
AY071612-1|AAL49234.1|  190|Drosophila melanogaster RE66104p pro...    33   0.29 
AE014296-3263|AAF49082.1|  190|Drosophila melanogaster CG7641-PA...    33   0.29 
BT001346-1|AAN71101.1|  163|Drosophila melanogaster AT23738p pro...    33   0.39 
AY283601-1|AAQ21104.1|  149|Drosophila melanogaster troponin C 2...    33   0.39 
AY113496-1|AAM29501.1|  149|Drosophila melanogaster RE53289p pro...    33   0.39 
AY070782-1|AAL48404.1|  148|Drosophila melanogaster AT10229p pro...    33   0.39 
AE014296-2871|AAF49371.1|  155|Drosophila melanogaster CG7930-PA...    33   0.39 
AE014134-892|AAF52229.2|  149|Drosophila melanogaster CG6514-PA ...    33   0.39 
AE013599-1246|AAF58687.1|  155|Drosophila melanogaster CG9073-PA...    33   0.39 
AE013599-546|AAF59165.1|  148|Drosophila melanogaster CG11165-PA...    33   0.39 
X76044-1|CAA53629.1|  155|Drosophila melanogaster troponin-C pro...    32   0.51 
U56245-1|AAC47350.1|  170|Drosophila melanogaster calcineurin B ...    32   0.51 
AY058534-1|AAL13763.1|  497|Drosophila melanogaster LD23951p pro...    32   0.51 
AE014297-2712|AAF55702.2|  497|Drosophila melanogaster CG4662-PA...    32   0.51 
AE014297-2711|AAN13811.1|  479|Drosophila melanogaster CG4662-PB...    32   0.51 
AY075218-1|AAL68085.1|  165|Drosophila melanogaster AT16150p pro...    32   0.68 
AF318283-1|AAK06752.1|  431|Drosophila melanogaster rhomboid-2 p...    32   0.68 
AE014297-3854|AAF56509.1|  165|Drosophila melanogaster CG5024-PA...    32   0.68 
X76043-1|CAA53628.1|  153|Drosophila melanogaster troponin-C pro...    31   0.90 
BT023956-1|ABB36460.1|  148|Drosophila melanogaster AT24185p pro...    31   0.90 
AY075534-1|AAL68341.1|  154|Drosophila melanogaster RH07835p pro...    31   0.90 
AE013599-43|AAF57350.1|  154|Drosophila melanogaster CG2981-PA p...    31   0.90 
Y09430-1|CAA70581.1| 4151|Drosophila melanogaster Kakapo protein.      31   1.2  
BT012468-1|AAS93739.1|  231|Drosophila melanogaster RE40519p pro...    31   1.2  
AF132555-1|AAD27854.2|  256|Drosophila melanogaster GM07659p pro...    31   1.2  
AF132154-1|AAD34742.1|  216|Drosophila melanogaster unknown prot...    31   1.2  
AE013599-3205|AAF46726.1|  216|Drosophila melanogaster CG9847-PA...    31   1.2  
AE013599-3204|AAM70900.1|  231|Drosophila melanogaster CG9847-PB...    31   1.2  
AE013599-547|AAM68876.1|  148|Drosophila melanogaster CG30378-PA...    31   1.2  
AY071327-1|AAL48949.2|  219|Drosophila melanogaster RE34768p pro...    31   1.6  
AE014296-3261|AAF49083.1|  186|Drosophila melanogaster CG7646-PA...    31   1.6  
AE013599-2248|AAF58016.1| 1087|Drosophila melanogaster CG3896-PA...    31   1.6  
AY283602-1|AAQ21105.1|  153|Drosophila melanogaster troponin C 4...    30   2.1  
AY070649-1|AAL48120.1|  153|Drosophila melanogaster RH03361p pro...    30   2.1  
AJ512938-1|CAD55594.1|  153|Drosophila melanogaster troponin C p...    30   2.1  
AE013599-81|AAF57327.2|  153|Drosophila melanogaster CG12408-PA ...    30   2.1  
M89628-1|AAB00734.1|  661|Drosophila melanogaster retinal degene...    30   2.7  
BT015959-1|AAV36844.1|  603|Drosophila melanogaster RH46370p pro...    30   2.7  
AE014296-3312|AAF49044.2|  603|Drosophila melanogaster CG6571-PA...    30   2.7  
AE014296-3311|AAO41219.1|  661|Drosophila melanogaster CG6571-PD...    30   2.7  
AE014296-3310|AAO41218.1|  661|Drosophila melanogaster CG6571-PC...    30   2.7  
AE014296-3309|AAO41217.1|  661|Drosophila melanogaster CG6571-PB...    30   2.7  
BT003499-1|AAO39503.1|  431|Drosophila melanogaster RE43527p pro...    29   3.6  
AE014298-1581|AAF48017.1|  424|Drosophila melanogaster CG11105-P...    29   3.6  
AE014298-1580|AAN09292.1|  488|Drosophila melanogaster CG11105-P...    29   3.6  
AE014296-254|AAF47499.2|  485|Drosophila melanogaster CG33166-PB...    29   3.6  
BT025010-1|ABE01240.1|  415|Drosophila melanogaster IP02589p pro...    29   6.3  
AY118682-1|AAM50542.1|  408|Drosophila melanogaster AT10584p pro...    29   6.3  
AY060866-1|AAL28414.1|  278|Drosophila melanogaster GM03574p pro...    29   6.3  
AE014134-1812|AAF52895.2|  408|Drosophila melanogaster CG31873-P...    29   6.3  
BT024934-1|ABE01164.1|  329|Drosophila melanogaster IP16409p pro...    28   8.4  
BT001764-1|AAN71519.1|  173|Drosophila melanogaster RH08915p pro...    28   8.4  
AY084110-1|AAL89848.1|  199|Drosophila melanogaster AT09395p pro...    28   8.4  
AY070689-1|AAL48160.1|  329|Drosophila melanogaster RH25118p pro...    28   8.4  
AE014297-1501|AAO41562.1|  164|Drosophila melanogaster CG33098-P...    28   8.4  
AE014297-1500|AAN13542.1|  199|Drosophila melanogaster CG33098-P...    28   8.4  
AE014297-1499|AAF54797.2|  230|Drosophila melanogaster CG33098-P...    28   8.4  
AE014296-216|AAN11468.1|  192|Drosophila melanogaster CG9148-PB,...    28   8.4  
AE014296-215|AAS64929.1|  329|Drosophila melanogaster CG9148-PC,...    28   8.4  
AE014296-214|AAF47468.2|  329|Drosophila melanogaster CG9148-PA,...    28   8.4  
AB011261-1|BAA34049.1|  193|Drosophila melanogaster supercoiling...    28   8.4  

>AY060767-1|AAL28315.1|  215|Drosophila melanogaster GH22994p
           protein.
          Length = 215

 Score =  130 bits (313), Expect = 2e-30
 Identities = 65/117 (55%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           RLLCLSRGA+GILGLGR FR MDDDGSK LN+EEF+ GI++TGL++++ E +++F+ FD 
Sbjct: 36  RLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDE 95

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL----*NKHSRSLTRLVTVQSQLMTLKGVYSV 593
           D SGSI++ EFL+K+RPPM +SR  +     NK  R    ++T+Q     LK VYSV
Sbjct: 96  DGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQD----LKNVYSV 148


>AE014297-1587|AAF54868.2|  215|Drosophila melanogaster CG10126-PA,
           isoform A protein.
          Length = 215

 Score =  130 bits (313), Expect = 2e-30
 Identities = 65/117 (55%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           RLLCLSRGA+GILGLGR FR MDDDGSK LN+EEF+ GI++TGL++++ E +++F+ FD 
Sbjct: 36  RLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDE 95

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL----*NKHSRSLTRLVTVQSQLMTLKGVYSV 593
           D SGSI++ EFL+K+RPPM +SR  +     NK  R    ++T+Q     LK VYSV
Sbjct: 96  DGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQD----LKNVYSV 148


>AE014297-1586|AAO41493.2|  227|Drosophila melanogaster CG10126-PB,
           isoform B protein.
          Length = 227

 Score =  130 bits (313), Expect = 2e-30
 Identities = 65/117 (55%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           RLLCLSRGA+GILGLGR FR MDDDGSK LN+EEF+ GI++TGL++++ E +++F+ FD 
Sbjct: 48  RLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDE 107

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL----*NKHSRSLTRLVTVQSQLMTLKGVYSV 593
           D SGSI++ EFL+K+RPPM +SR  +     NK  R    ++T+Q     LK VYSV
Sbjct: 108 DGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQD----LKNVYSV 160


>AE014297-1584|AAF54865.2|  213|Drosophila melanogaster CG31345-PA
           protein.
          Length = 213

 Score =  119 bits (287), Expect = 3e-27
 Identities = 60/113 (53%), Positives = 77/113 (68%)
 Frame = +3

Query: 255 RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDT 434
           RL C SRGA+GILGL R FR MDDDGSK L+ EEF  G+ + GL+L  SE +E+FS+FDT
Sbjct: 34  RLQCFSRGATGILGLSRSFRVMDDDGSKSLSPEEFKKGVTDIGLDLTDSEIDEMFSRFDT 93

Query: 435 DSSGSISLDEFLIKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLKGVYSV 593
           D SG+I++ EFL+K+RPPM+ SR  +  K    +      Q  +  LK VYSV
Sbjct: 94  DGSGNINMTEFLVKLRPPMNNSRISIIEKAFDKMDANGDGQITVTDLKNVYSV 146


>AY122181-1|AAM52693.1| 1140|Drosophila melanogaster LD39385p
           protein.
          Length = 1140

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
           +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 736 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 795

Query: 486 PMSESR 503
              E +
Sbjct: 796 DWQERK 801


>AF200425-1|AAF24343.1| 5201|Drosophila melanogaster Short stop/Kakapo
            long isoform protein.
          Length = 5201

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 4775 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 4834

Query: 486  PMSESR 503
               E +
Sbjct: 4835 DWQERK 4840


>AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-PH,
            isoform H protein.
          Length = 8805

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 8379 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 8438

Query: 486  PMSESR 503
               E +
Sbjct: 8439 DWQERK 8444


>AE013599-1791|AAM68562.1| 5160|Drosophila melanogaster CG18076-PC,
            isoform C protein.
          Length = 5160

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 4734 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 4793

Query: 486  PMSESR 503
               E +
Sbjct: 4794 DWQERK 4799


>AE013599-1790|AAF58319.3| 5501|Drosophila melanogaster CG18076-PA,
            isoform A protein.
          Length = 5501

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 5075 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 5134

Query: 486  PMSESR 503
               E +
Sbjct: 5135 DWQERK 5140


>AE013599-1789|AAM68561.1| 5201|Drosophila melanogaster CG18076-PE,
            isoform E protein.
          Length = 5201

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 4775 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 4834

Query: 486  PMSESR 503
               E +
Sbjct: 4835 DWQERK 4840


>AE013599-1788|AAG22268.2| 5390|Drosophila melanogaster CG18076-PB,
            isoform B protein.
          Length = 5390

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 4964 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 5023

Query: 486  PMSESR 503
               E +
Sbjct: 5024 DWQERK 5029


>AE013599-1787|AAF58317.1| 5385|Drosophila melanogaster CG18076-PG,
            isoform G protein.
          Length = 5385

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRP 485
            +FR+MD D + ++ ++ F+ GI  T  + +  E + +   FD +  G I   EF+  +RP
Sbjct: 4964 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRP 5023

Query: 486  PMSESR 503
               E +
Sbjct: 5024 DWQERK 5029


>AY071434-1|AAL49056.1|  387|Drosophila melanogaster RE52086p
           protein.
          Length = 387

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 2/77 (2%)
 Frame = +3

Query: 246 GET--RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELF 419
           GET  +  C+S+G   +      FR  D DG   + KEE    ++  G      E +E+ 
Sbjct: 197 GETLHKRRCISKGQ--MREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEML 254

Query: 420 SQFDTDSSGSISLDEFL 470
            + D D  G++S +EF+
Sbjct: 255 QEIDVDGDGNVSFEEFV 271


>AL109630-13|CAB51683.1|  426|Drosophila melanogaster EG:BACR7A4.12
           protein.
          Length = 426

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 2/77 (2%)
 Frame = +3

Query: 246 GET--RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELF 419
           GET  +  C+S+G   +      FR  D DG   + KEE    ++  G      E +E+ 
Sbjct: 236 GETLHKRRCISKGQ--MREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEML 293

Query: 420 SQFDTDSSGSISLDEFL 470
            + D D  G++S +EF+
Sbjct: 294 QEIDVDGDGNVSFEEFV 310


>AE014298-139|AAF45577.3|  387|Drosophila melanogaster CG11638-PA
           protein.
          Length = 387

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 2/77 (2%)
 Frame = +3

Query: 246 GET--RLLCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELF 419
           GET  +  C+S+G   +      FR  D DG   + KEE    ++  G      E +E+ 
Sbjct: 197 GETLHKRRCISKGQ--MREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEML 254

Query: 420 SQFDTDSSGSISLDEFL 470
            + D D  G++S +EF+
Sbjct: 255 QEIDVDGDGNVSFEEFV 271


>BT003594-1|AAO39597.1|  533|Drosophila melanogaster HL01250p
           protein.
          Length = 533

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/63 (30%), Positives = 36/63 (57%)
 Frame = +3

Query: 282 SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           S +L   R    +  + S+ +++E F+  ++  G +LN+ +A+ LF   DTD+ G +S D
Sbjct: 439 SDLLTFLRALIHLYSESSQQIDRESFVRLMRHAGGKLNEQKAQALFYALDTDNLGYVSFD 498

Query: 462 EFL 470
            F+
Sbjct: 499 SFV 501


>AE014298-1344|ABI30972.1|  533|Drosophila melanogaster CG32699-PB,
           isoform B protein.
          Length = 533

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/63 (30%), Positives = 36/63 (57%)
 Frame = +3

Query: 282 SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           S +L   R    +  + S+ +++E F+  ++  G +LN+ +A+ LF   DTD+ G +S D
Sbjct: 439 SDLLTFLRALIHLYSESSQQIDRESFVRLMRHAGGKLNEQKAQALFYALDTDNLGYVSFD 498

Query: 462 EFL 470
            F+
Sbjct: 499 SFV 501


>AE014134-675|AAN10361.1|  148|Drosophila melanogaster CG31960-PA
           protein.
          Length = 148

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/71 (26%), Positives = 38/71 (53%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L  I+  +D D    +  +E    I+  G + N+SE + + ++ D+D +GSI+ +EF   
Sbjct: 12  LKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEFCNV 71

Query: 477 IRPPMSESRRK 509
           I   M ++ ++
Sbjct: 72  ILRKMHDTNKE 82



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNK-SEAEELFSQFDTDSSGSISLDE 464
           +   +D DG+  + KEEF   I     + NK  E  + F  FD +++G IS  E
Sbjct: 51  MINEVDSDGNGSIAKEEFCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTE 104



 Score = 29.9 bits (64), Expect = 2.7
 Identities = 14/53 (26%), Positives = 24/53 (45%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           FR  D + +  ++  E        G +L   E EE+  ++D D    I+ +EF
Sbjct: 89  FRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLDQDNHINFEEF 141


>AY122132-1|AAM52644.1|  520|Drosophila melanogaster GH25190p
           protein.
          Length = 520

 Score = 37.5 bits (83), Expect = 0.014
 Identities = 21/62 (33%), Positives = 32/62 (51%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L RIF ++D DG   ++  +    + E G  L+   AE+   Q D D SG++   EFL  
Sbjct: 117 LERIFNKLDRDGDGRIDIHDLSAALHEFG--LSSVYAEKFLQQSDKDQSGNVGFAEFLHY 174

Query: 477 IR 482
           +R
Sbjct: 175 VR 176



 Score = 29.5 bits (63), Expect = 3.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKGCL 586
           +E+ F KLD+ GDG I I D+   L
Sbjct: 117 LERIFNKLDRDGDGRIDIHDLSAAL 141


>AE014296-2136|AAF49921.2|  583|Drosophila melanogaster CG32103-PB,
           isoform B protein.
          Length = 583

 Score = 37.5 bits (83), Expect = 0.014
 Identities = 21/62 (33%), Positives = 32/62 (51%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L RIF ++D DG   ++  +    + E G  L+   AE+   Q D D SG++   EFL  
Sbjct: 117 LERIFNKLDRDGDGRIDIHDLSAALHEFG--LSSVYAEKFLQQSDKDQSGNVGFAEFLHY 174

Query: 477 IR 482
           +R
Sbjct: 175 VR 176



 Score = 29.5 bits (63), Expect = 3.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKGCL 586
           +E+ F KLD+ GDG I I D+   L
Sbjct: 117 LERIFNKLDRDGDGRIDIHDLSAAL 141


>AE014296-2135|AAS65015.1|  583|Drosophila melanogaster CG32103-PA,
           isoform A protein.
          Length = 583

 Score = 37.5 bits (83), Expect = 0.014
 Identities = 21/62 (33%), Positives = 32/62 (51%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           L RIF ++D DG   ++  +    + E G  L+   AE+   Q D D SG++   EFL  
Sbjct: 117 LERIFNKLDRDGDGRIDIHDLSAALHEFG--LSSVYAEKFLQQSDKDQSGNVGFAEFLHY 174

Query: 477 IR 482
           +R
Sbjct: 175 VR 176



 Score = 29.5 bits (63), Expect = 3.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKGCL 586
           +E+ F KLD+ GDG I I D+   L
Sbjct: 117 LERIFNKLDRDGDGRIDIHDLSAAL 141


>BT003768-1|AAO41447.1|  170|Drosophila melanogaster RE27048p
           protein.
          Length = 170

 Score = 35.1 bits (77), Expect = 0.073
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C +  A  I  LG+ FR++D D S  L+ +EF+  + E  L+ N    + +   FD D 
Sbjct: 11  MCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFM-SLPE--LQQNPL-VQRVIDIFDADG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>AY089602-1|AAL90340.1|  170|Drosophila melanogaster RE19603p
           protein.
          Length = 170

 Score = 35.1 bits (77), Expect = 0.073
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C +  A  I  LG+ FR++D D S  L+ +EF+  + E  L+ N    + +   FD D 
Sbjct: 11  MCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFM-SLPE--LQQNPL-VQRVIDIFDADG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>AE013599-496|AAF59195.2|  170|Drosophila melanogaster CG11217-PA
           protein.
          Length = 170

 Score = 35.1 bits (77), Expect = 0.073
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C +  A  I  LG+ FR++D D S  L+ +EF+  + E  L+ N    + +   FD D 
Sbjct: 11  MCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFM-SLPE--LQQNPL-VQRVIDIFDADG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>M97215-1|AAA28411.1|  170|Drosophila melanogaster calcineurin B
           protein.
          Length = 170

 Score = 34.7 bits (76), Expect = 0.096
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C +  A  I  LG+ FR++D D S  L+ +EF+  + E  L+ N    + +   FD D 
Sbjct: 11  MCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFM-SLPE--LQQNPL-VQRVIDIFDADG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>AY070642-1|AAL48113.1|  170|Drosophila melanogaster RH02643p
           protein.
          Length = 170

 Score = 34.7 bits (76), Expect = 0.096
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C +  A  I  LG+ FR++D D S  L+ +EF+  + E  L+ N    + +   FD D 
Sbjct: 11  MCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFM-SLPE--LQQNPL-VQRVIDIFDADG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>AE014298-728|AAF46026.1|  170|Drosophila melanogaster CG4209-PA
           protein.
          Length = 170

 Score = 34.7 bits (76), Expect = 0.096
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C +  A  I  LG+ FR++D D S  L+ +EF+  + E  L+ N    + +   FD D 
Sbjct: 11  MCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFM-SLPE--LQQNPL-VQRVIDIFDADG 66

Query: 441 SGSISLDEFL 470
           +G +   EF+
Sbjct: 67  NGEVDFKEFI 76


>BT003178-1|AAO24933.1|  476|Drosophila melanogaster RH09265p
           protein.
          Length = 476

 Score = 34.3 bits (75), Expect = 0.13
 Identities = 30/97 (30%), Positives = 42/97 (43%), Gaps = 2/97 (2%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL- 470
           G  R+FR + D G     +  FL  I    L   KS     F+ FDTD +  +  DEFL 
Sbjct: 159 GSTRLFRNLRDKGIVSYTEYLFLLSI----LTKPKSGFRIAFNMFDTDGNQRVDKDEFLV 214

Query: 471 -IKIRPPMSESRRKL*NKHSRSLTRLVTVQSQLMTLK 578
            I I     +  + +  +  R L+RLV+   Q    K
Sbjct: 215 IISILAGALKDTQNVDPQTKRILSRLVSYDEQSQMTK 251



 Score = 32.7 bits (71), Expect = 0.39
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKE-TGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           I  RM     + ++K+EF   +K  TG +L+    + +F+ FD D  G +S  EF+
Sbjct: 382 IAMRMYTLADRAISKDEFARAVKICTGYKLSPHLIDTVFAIFDADGDGLLSYKEFI 437


>BT001616-1|AAN71371.1|  155|Drosophila melanogaster RE34610p
           protein.
          Length = 155

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 16/58 (27%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D+ G+  +        +KE   +L + E + +  + D+D SG++  DEF+
Sbjct: 92  LREAFRLYDEQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFM 149


>Y00133-1|CAA68327.1|  148|Drosophila melanogaster protein (
           Drosophila melanogastercalmodulin mRNA. ).
          Length = 148

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 16  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 75

Query: 489 MSES 500
           M ++
Sbjct: 76  MKDT 79


>X76042-1|CAA53627.1|  155|Drosophila melanogaster troponin-C
           protein.
          Length = 155

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D  G+  +        +KE   +L + E + +  + D+D SG++  DEF+
Sbjct: 92  LAEAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFM 149


>BT003282-1|AAO25039.1|  149|Drosophila melanogaster LD02334p
           protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>AY118890-1|AAM50750.1|  149|Drosophila melanogaster LD01127p
           protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>AE013599-1432|AAF58543.1|  149|Drosophila melanogaster CG8472-PB,
           isoform B protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>AE013599-1431|AAF58542.1|  149|Drosophila melanogaster CG8472-PA,
           isoform A protein.
          Length = 149

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 15/64 (23%), Positives = 31/64 (48%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           F   D DG   +  +E    ++  G    ++E +++ ++ D D +G+I   EFL  +   
Sbjct: 17  FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76

Query: 489 MSES 500
           M ++
Sbjct: 77  MKDT 80


>U15735-1|AAA62152.1|  190|Drosophila melanogaster DrosNCa protein.
          Length = 190

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EFL  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEML 122


>AY071612-1|AAL49234.1|  190|Drosophila melanogaster RE66104p
           protein.
          Length = 190

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EFL  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEML 122


>AE014296-3263|AAF49082.1|  190|Drosophila melanogaster CG7641-PA
           protein.
          Length = 190

 Score = 33.1 bits (72), Expect = 0.29
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           +FR  D +G   ++  EFL  +  T     + + +  FS +D D +G IS  E L
Sbjct: 68  VFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEML 122


>BT001346-1|AAN71101.1|  163|Drosophila melanogaster AT23738p
           protein.
          Length = 163

 Score = 32.7 bits (71), Expect = 0.39
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  +   E        G++L+  E EE+  ++D D    ++ +EF+
Sbjct: 100 LREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEFV 157


>AY283601-1|AAQ21104.1|  149|Drosophila melanogaster troponin C 25D
           protein.
          Length = 149

 Score = 32.7 bits (71), Expect = 0.39
 Identities = 15/58 (25%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G+  +        +     +L+ S+ + + ++ DTD SG++  DEF+
Sbjct: 86  LKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEIDTDGSGTVDFDEFM 143


>AY113496-1|AAM29501.1|  149|Drosophila melanogaster RE53289p
           protein.
          Length = 149

 Score = 32.7 bits (71), Expect = 0.39
 Identities = 15/58 (25%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G+  +        +     +L+ S+ + + ++ DTD SG++  DEF+
Sbjct: 86  LKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEIDTDGSGTVDFDEFM 143


>AY070782-1|AAL48404.1|  148|Drosophila melanogaster AT10229p
           protein.
          Length = 148

 Score = 32.7 bits (71), Expect = 0.39
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  +   E        G++L+  E EE+  ++D D    ++ +EF+
Sbjct: 85  LREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEFV 142


>AE014296-2871|AAF49371.1|  155|Drosophila melanogaster CG7930-PA,
           isoform A protein.
          Length = 155

 Score = 32.7 bits (71), Expect = 0.39
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D  G+  +        +KE   +L + E + +  + D+D SG++  DEF+
Sbjct: 92  LREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFM 149


>AE014134-892|AAF52229.2|  149|Drosophila melanogaster CG6514-PA
           protein.
          Length = 149

 Score = 32.7 bits (71), Expect = 0.39
 Identities = 15/58 (25%), Positives = 29/58 (50%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G+  +        +     +L+ S+ + + ++ DTD SG++  DEF+
Sbjct: 86  LKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEIDTDGSGTVDFDEFM 143


>AE013599-1246|AAF58687.1|  155|Drosophila melanogaster CG9073-PA
           protein.
          Length = 155

 Score = 32.7 bits (71), Expect = 0.39
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D  G+  +        +KE   +L + E + +  + D+D SG++  DEF+
Sbjct: 92  LREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFM 149


>AE013599-546|AAF59165.1|  148|Drosophila melanogaster CG11165-PA
           protein.
          Length = 148

 Score = 32.7 bits (71), Expect = 0.39
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  +   E        G++L+  E EE+  ++D D    ++ +EF+
Sbjct: 85  LREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEFV 142


>X76044-1|CAA53629.1|  155|Drosophila melanogaster troponin-C
           protein.
          Length = 155

 Score = 32.3 bits (70), Expect = 0.51
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D  G+  +        +KE   +L + E + +  + D+D SG++  DEF+
Sbjct: 96  FRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFM 149


>U56245-1|AAC47350.1|  170|Drosophila melanogaster calcineurin B
           protein.
          Length = 170

 Score = 32.3 bits (70), Expect = 0.51
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = +3

Query: 261 LCLSRGASGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDS 440
           +C +  A  I  LG+ FR++D D S  L+ +EF+  + E  L+ N    + +   FD D 
Sbjct: 11  MCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFM-SLPE--LQQNPL-VQRVIDIFDADG 66

Query: 441 SGSISLDEFL 470
           +  +   EF+
Sbjct: 67  NXEVDFKEFI 76



 Score = 28.3 bits (60), Expect = 8.4
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNK-SEAEELFSQFDTDSSGSISLDE 464
           R+    D DG+  ++ +EF+ G+ +  ++ +K S+    F  +D D+ G IS  E
Sbjct: 57  RVIDIFDADGNXEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGE 111


>AY058534-1|AAL13763.1|  497|Drosophila melanogaster LD23951p
           protein.
          Length = 497

 Score = 32.3 bits (70), Expect = 0.51
 Identities = 22/62 (35%), Positives = 29/62 (46%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           G  R+FR + D G     +  FL  I    L   KS     F+ FDTD +  +  DEFL+
Sbjct: 159 GSTRLFRNLRDKGIVSYTEYLFLLSI----LTKPKSGFRIAFNMFDTDGNQRVDKDEFLV 214

Query: 474 KI 479
            I
Sbjct: 215 II 216



 Score = 32.3 bits (70), Expect = 0.51
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKE-TGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           I  RM     + ++K+EF   +K  TG +L+    + +F+ FD D  G +S  EF+
Sbjct: 385 IAMRMYTLADRAISKDEFSRAVKICTGYKLSPHLIDTVFAIFDADGDGLLSYKEFI 440


>AE014297-2712|AAF55702.2|  497|Drosophila melanogaster CG4662-PA,
           isoform A protein.
          Length = 497

 Score = 32.3 bits (70), Expect = 0.51
 Identities = 22/62 (35%), Positives = 29/62 (46%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           G  R+FR + D G     +  FL  I    L   KS     F+ FDTD +  +  DEFL+
Sbjct: 159 GSTRLFRNLRDKGIVSYTEYLFLLSI----LTKPKSGFRIAFNMFDTDGNQRVDKDEFLV 214

Query: 474 KI 479
            I
Sbjct: 215 II 216



 Score = 32.3 bits (70), Expect = 0.51
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKE-TGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           I  RM     + ++K+EF   +K  TG +L+    + +F+ FD D  G +S  EF+
Sbjct: 385 IAMRMYTLADRAISKDEFSRAVKICTGYKLSPHLIDTVFAIFDADGDGLLSYKEFI 440


>AE014297-2711|AAN13811.1|  479|Drosophila melanogaster CG4662-PB,
           isoform B protein.
          Length = 479

 Score = 32.3 bits (70), Expect = 0.51
 Identities = 22/62 (35%), Positives = 29/62 (46%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLI 473
           G  R+FR + D G     +  FL  I    L   KS     F+ FDTD +  +  DEFL+
Sbjct: 159 GSTRLFRNLRDKGIVSYTEYLFLLSI----LTKPKSGFRIAFNMFDTDGNQRVDKDEFLV 214

Query: 474 KI 479
            I
Sbjct: 215 II 216



 Score = 32.3 bits (70), Expect = 0.51
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKE-TGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           I  RM     + ++K+EF   +K  TG +L+    + +F+ FD D  G +S  EF+
Sbjct: 385 IAMRMYTLADRAISKDEFSRAVKICTGYKLSPHLIDTVFAIFDADGDGLLSYKEFI 440


>AY075218-1|AAL68085.1|  165|Drosophila melanogaster AT16150p
           protein.
          Length = 165

 Score = 31.9 bits (69), Expect = 0.68
 Identities = 16/51 (31%), Positives = 28/51 (54%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           F+  D DGS  +++ EF   + E G E+ + E EE+    D D++  + +D
Sbjct: 106 FKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIR--DADANTELKID 154



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/54 (25%), Positives = 28/54 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   DDD +K++  +     ++       ++E ++  ++ DTD SG + L +FL
Sbjct: 33  FALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFL 86


>AF318283-1|AAK06752.1|  431|Drosophila melanogaster rhomboid-2
           protein.
          Length = 431

 Score = 31.9 bits (69), Expect = 0.68
 Identities = 13/34 (38%), Positives = 22/34 (64%)
 Frame = +3

Query: 387 ELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           EL + + + LF  FD +  G IS++EFL+ ++ P
Sbjct: 30  ELLRDKWKLLFDMFDPEGFGEISVEEFLVALKSP 63


>AE014297-3854|AAF56509.1|  165|Drosophila melanogaster CG5024-PA
           protein.
          Length = 165

 Score = 31.9 bits (69), Expect = 0.68
 Identities = 16/51 (31%), Positives = 28/51 (54%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           F+  D DGS  +++ EF   + E G E+ + E EE+    D D++  + +D
Sbjct: 106 FKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIR--DADANTELKID 154



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/54 (25%), Positives = 28/54 (51%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           F   DDD +K++  +     ++       ++E ++  ++ DTD SG + L +FL
Sbjct: 33  FALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFL 86


>X76043-1|CAA53628.1|  153|Drosophila melanogaster troponin-C
           protein.
          Length = 153

 Score = 31.5 bits (68), Expect = 0.90
 Identities = 14/58 (24%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G+  +        ++E   +L   + + +  + D+D SG++  DEF+
Sbjct: 89  LKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEIDSDGSGTVDFDEFM 146


>BT023956-1|ABB36460.1|  148|Drosophila melanogaster AT24185p
           protein.
          Length = 148

 Score = 31.5 bits (68), Expect = 0.90
 Identities = 14/58 (24%), Positives = 27/58 (46%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D D +  +   E        G++L+  + EE+  ++D D    ++ +EF+
Sbjct: 85  LREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDDLEEMIREYDLDQDNHLNYEEFV 142


>AY075534-1|AAL68341.1|  154|Drosophila melanogaster RH07835p
           protein.
          Length = 154

 Score = 31.5 bits (68), Expect = 0.90
 Identities = 14/58 (24%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G+  +        ++E   +L   + + +  + D+D SG++  DEF+
Sbjct: 89  LKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEIDSDGSGTVDFDEFM 146


>AE013599-43|AAF57350.1|  154|Drosophila melanogaster CG2981-PA
           protein.
          Length = 154

 Score = 31.5 bits (68), Expect = 0.90
 Identities = 14/58 (24%), Positives = 28/58 (48%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G+  +        ++E   +L   + + +  + D+D SG++  DEF+
Sbjct: 89  LKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEIDSDGSGTVDFDEFM 146


>Y09430-1|CAA70581.1| 4151|Drosophila melanogaster Kakapo protein.
          Length = 4151

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = +3

Query: 306  IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEEL--FSQFDTDSSGSISLDEFLIKI 479
            +FR+MD D + ++ ++ F+ GI  T  + +  E + +  F +    + G I   EF+  +
Sbjct: 3729 LFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVAGFVRI-AMAEGLIDWQEFIAAL 3787

Query: 480  RPPMSESR 503
            RP   E +
Sbjct: 3788 RPDWQERK 3795


>BT012468-1|AAS93739.1|  231|Drosophila melanogaster RE40519p
           protein.
          Length = 231

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 14/68 (20%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKE--TGLELNKSE------------AEELFSQFDTDSS 443
           +F+ +DD+  K L++EE    +K+  T +E   SE             EE+F   D D +
Sbjct: 156 VFKEIDDNADKQLSREEVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHEDKDKN 215

Query: 444 GSISLDEF 467
           G IS DEF
Sbjct: 216 GFISHDEF 223


>AF132555-1|AAD27854.2|  256|Drosophila melanogaster GM07659p
           protein.
          Length = 256

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 14/68 (20%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKE--TGLELNKSE------------AEELFSQFDTDSS 443
           +F+ +DD+  K L++EE    +K+  T +E   SE             EE+F   D D +
Sbjct: 181 VFKEIDDNADKQLSREEVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHEDKDKN 240

Query: 444 GSISLDEF 467
           G IS DEF
Sbjct: 241 GFISHDEF 248


>AF132154-1|AAD34742.1|  216|Drosophila melanogaster unknown
           protein.
          Length = 216

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 14/68 (20%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKE--TGLELNKSE------------AEELFSQFDTDSS 443
           +F+ +DD+  K L++EE    +K+  T +E   SE             EE+F   D D +
Sbjct: 141 VFKEIDDNADKQLSREEVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHEDKDKN 200

Query: 444 GSISLDEF 467
           G IS DEF
Sbjct: 201 GFISHDEF 208


>AE013599-3205|AAF46726.1|  216|Drosophila melanogaster CG9847-PA,
           isoform A protein.
          Length = 216

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 14/68 (20%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKE--TGLELNKSE------------AEELFSQFDTDSS 443
           +F+ +DD+  K L++EE    +K+  T +E   SE             EE+F   D D +
Sbjct: 141 VFKEIDDNADKQLSREEVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHEDKDKN 200

Query: 444 GSISLDEF 467
           G IS DEF
Sbjct: 201 GFISHDEF 208


>AE013599-3204|AAM70900.1|  231|Drosophila melanogaster CG9847-PB,
           isoform B protein.
          Length = 231

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 14/68 (20%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKE--TGLELNKSE------------AEELFSQFDTDSS 443
           +F+ +DD+  K L++EE    +K+  T +E   SE             EE+F   D D +
Sbjct: 156 VFKEIDDNADKQLSREEVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHEDKDKN 215

Query: 444 GSISLDEF 467
           G IS DEF
Sbjct: 216 GFISHDEF 223


>AE013599-547|AAM68876.1|  148|Drosophila melanogaster CG30378-PA
           protein.
          Length = 148

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 16/67 (23%), Positives = 30/67 (44%)
 Frame = +3

Query: 282 SGILGLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLD 461
           + ++ L + F+  D          E    +   G ++++ +  ELF   D D  G IS +
Sbjct: 81  NSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQDIDQDKDGKISFN 140

Query: 462 EFLIKIR 482
           EF+  +R
Sbjct: 141 EFVTAMR 147


>AY071327-1|AAL48949.2|  219|Drosophila melanogaster RE34768p
           protein.
          Length = 219

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           FR  D D S  ++K E    +   G  L+    + L  +FD    G+I  D+F+
Sbjct: 85  FRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFI 138


>AE014296-3261|AAF49083.1|  186|Drosophila melanogaster CG7646-PA,
           isoform A protein.
          Length = 186

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 15/53 (28%), Positives = 26/53 (49%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDE 464
           +FR  D D +  ++ +EFL  I  T     + + +  F  +D D +G I + E
Sbjct: 70  VFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQE 122


>AE013599-2248|AAF58016.1| 1087|Drosophila melanogaster CG3896-PA
           protein.
          Length = 1087

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +3

Query: 408 EELFSQFDTDSSGSISLDEFL 470
           E +F  FD D+SGSISL EF+
Sbjct: 112 ERVFQIFDKDNSGSISLQEFI 132



 Score = 29.5 bits (63), Expect = 3.6
 Identities = 18/66 (27%), Positives = 30/66 (45%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIR 482
           R+F+  D D S  ++ +EF+  I +   +    +   LF  +D D  G I   E    IR
Sbjct: 113 RVFQIFDKDNSGSISLQEFIDAIHQFSGQSADDKIRFLFKVYDIDGDGLIQHKELHDVIR 172

Query: 483 PPMSES 500
             + E+
Sbjct: 173 HCIKEN 178


>AY283602-1|AAQ21105.1|  153|Drosophila melanogaster troponin C 41F
           protein.
          Length = 153

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G   L        + E   +L+  + + +  + D D SG++  DEF+
Sbjct: 91  LKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFDEFM 148


>AY070649-1|AAL48120.1|  153|Drosophila melanogaster RH03361p
           protein.
          Length = 153

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G   L        + E   +L+  + + +  + D D SG++  DEF+
Sbjct: 91  LKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFDEFM 148


>AJ512938-1|CAD55594.1|  153|Drosophila melanogaster troponin C
           protein.
          Length = 153

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G   L        + E   +L+  + + +  + D D SG++  DEF+
Sbjct: 91  LKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFDEFM 148


>AE013599-81|AAF57327.2|  153|Drosophila melanogaster CG12408-PA
           protein.
          Length = 153

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           L   FR  D +G   L        + E   +L+  + + +  + D D SG++  DEF+
Sbjct: 91  LKEAFRVYDKEGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFDEFM 148


>M89628-1|AAB00734.1|  661|Drosophila melanogaster retinal
           degeneration C protein protein.
          Length = 661

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 384 LELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  NK+    +F+  D D+SG I+LDEF
Sbjct: 524 LYANKASLVAIFNIIDADNSGEITLDEF 551


>BT015959-1|AAV36844.1|  603|Drosophila melanogaster RH46370p
           protein.
          Length = 603

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 384 LELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  NK+    +F+  D D+SG I+LDEF
Sbjct: 466 LYANKASLVAIFNIIDADNSGEITLDEF 493


>AE014296-3312|AAF49044.2|  603|Drosophila melanogaster CG6571-PA,
           isoform A protein.
          Length = 603

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 384 LELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  NK+    +F+  D D+SG I+LDEF
Sbjct: 466 LYANKASLVAIFNIIDADNSGEITLDEF 493


>AE014296-3311|AAO41219.1|  661|Drosophila melanogaster CG6571-PD,
           isoform D protein.
          Length = 661

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 384 LELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  NK+    +F+  D D+SG I+LDEF
Sbjct: 524 LYANKASLVAIFNIIDADNSGEITLDEF 551


>AE014296-3310|AAO41218.1|  661|Drosophila melanogaster CG6571-PC,
           isoform C protein.
          Length = 661

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 384 LELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  NK+    +F+  D D+SG I+LDEF
Sbjct: 524 LYANKASLVAIFNIIDADNSGEITLDEF 551


>AE014296-3309|AAO41217.1|  661|Drosophila melanogaster CG6571-PB,
           isoform B protein.
          Length = 661

 Score = 29.9 bits (64), Expect = 2.7
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 384 LELNKSEAEELFSQFDTDSSGSISLDEF 467
           L  NK+    +F+  D D+SG I+LDEF
Sbjct: 524 LYANKASLVAIFNIIDADNSGEITLDEF 551


>BT003499-1|AAO39503.1|  431|Drosophila melanogaster RE43527p
           protein.
          Length = 431

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +3

Query: 387 ELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           EL + + + LF  FD +  G IS++EFL  ++ P
Sbjct: 30  ELLRDKWKLLFDMFDPEGFGEISVEEFLEALKSP 63


>AE014298-1581|AAF48017.1|  424|Drosophila melanogaster CG11105-PA,
           isoform A protein.
          Length = 424

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSESR 503
           K + E++F + DT+  G ++L+EFL   R   + SR
Sbjct: 70  KGKVEQIFQKMDTNRDGVVTLEEFLEACRNDDAISR 105


>AE014298-1580|AAN09292.1|  488|Drosophila melanogaster CG11105-PB,
           isoform B protein.
          Length = 488

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSESR 503
           K + E++F + DT+  G ++L+EFL   R   + SR
Sbjct: 134 KGKVEQIFQKMDTNRDGVVTLEEFLEACRNDDAISR 169


>AE014296-254|AAF47499.2|  485|Drosophila melanogaster CG33166-PB,
           isoform B protein.
          Length = 485

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +3

Query: 387 ELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPP 488
           EL + + + LF  FD +  G IS++EFL  ++ P
Sbjct: 84  ELLRDKWKLLFDMFDPEGFGEISVEEFLEALKSP 117


>BT025010-1|ABE01240.1|  415|Drosophila melanogaster IP02589p
           protein.
          Length = 415

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 13/62 (20%), Positives = 32/62 (51%)
 Frame = +1

Query: 268 CPEVLQGSWDLEEFSVAWMMMEVNY*TKKNSFMASRKQGWNLIKVKPKNSSVNSTQTVVA 447
           C +  +GS +  + ++  +  + N+   ++ F++S + GW  IK  P+ +      ++V 
Sbjct: 322 CSKKFEGSAEASQININCVQNKDNFAELESQFISSLQPGWEFIKQIPEVTCSKILPSLVV 381

Query: 448 QS 453
           +S
Sbjct: 382 KS 383


>AY118682-1|AAM50542.1|  408|Drosophila melanogaster AT10584p
           protein.
          Length = 408

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 13/62 (20%), Positives = 32/62 (51%)
 Frame = +1

Query: 268 CPEVLQGSWDLEEFSVAWMMMEVNY*TKKNSFMASRKQGWNLIKVKPKNSSVNSTQTVVA 447
           C +  +GS +  + ++  +  + N+   ++ F++S + GW  IK  P+ +      ++V 
Sbjct: 306 CSKKFEGSAEASQININCVQNKDNFAELESQFISSLQPGWEFIKQIPEVTCSKILPSLVV 365

Query: 448 QS 453
           +S
Sbjct: 366 KS 367


>AY060866-1|AAL28414.1|  278|Drosophila melanogaster GM03574p
           protein.
          Length = 278

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 13/62 (20%), Positives = 32/62 (51%)
 Frame = +1

Query: 268 CPEVLQGSWDLEEFSVAWMMMEVNY*TKKNSFMASRKQGWNLIKVKPKNSSVNSTQTVVA 447
           C +  +GS +  + ++  +  + N+   ++ F++S + GW  IK  P+ +      ++V 
Sbjct: 176 CSKKFEGSAEASQININCVQNKDNFAELESQFISSLQPGWEFIKQIPEVTCSKILPSLVV 235

Query: 448 QS 453
           +S
Sbjct: 236 KS 237


>AE014134-1812|AAF52895.2|  408|Drosophila melanogaster CG31873-PA
           protein.
          Length = 408

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 13/62 (20%), Positives = 32/62 (51%)
 Frame = +1

Query: 268 CPEVLQGSWDLEEFSVAWMMMEVNY*TKKNSFMASRKQGWNLIKVKPKNSSVNSTQTVVA 447
           C +  +GS +  + ++  +  + N+   ++ F++S + GW  IK  P+ +      ++V 
Sbjct: 306 CSKKFEGSAEASQININCVQNKDNFAELESQFISSLQPGWEFIKQIPEVTCSKILPSLVV 365

Query: 448 QS 453
           +S
Sbjct: 366 KS 367


>BT024934-1|ABE01164.1|  329|Drosophila melanogaster IP16409p
           protein.
          Length = 329

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 312 RRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           R +D DG   LN+EE    I     + +++EA+ L  + D D    ++ +E L K
Sbjct: 255 RDLDKDG--YLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDK 307


>BT001764-1|AAN71519.1|  173|Drosophila melanogaster RH08915p
           protein.
          Length = 173

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 399 SEAEELFSQFDTDSSGSISLDE 464
           +E +E+FS FDTD  G IS D+
Sbjct: 27  AELKEVFSLFDTDCDGLISKDD 48


>AY084110-1|AAL89848.1|  199|Drosophila melanogaster AT09395p
           protein.
          Length = 199

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 399 SEAEELFSQFDTDSSGSISLDE 464
           +E +E+FS FDTD  G IS D+
Sbjct: 84  AELKEVFSLFDTDCDGLISKDD 105


>AY070689-1|AAL48160.1|  329|Drosophila melanogaster RH25118p
           protein.
          Length = 329

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 312 RRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           R +D DG   LN+EE    I     + +++EA+ L  + D D    ++ +E L K
Sbjct: 255 RDLDKDG--YLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDK 307


>AE014297-1501|AAO41562.1|  164|Drosophila melanogaster CG33098-PD,
           isoform D protein.
          Length = 164

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 399 SEAEELFSQFDTDSSGSISLDE 464
           +E +E+FS FDTD  G IS D+
Sbjct: 18  AELKEVFSLFDTDCDGLISKDD 39


>AE014297-1500|AAN13542.1|  199|Drosophila melanogaster CG33098-PC,
           isoform C protein.
          Length = 199

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 399 SEAEELFSQFDTDSSGSISLDE 464
           +E +E+FS FDTD  G IS D+
Sbjct: 84  AELKEVFSLFDTDCDGLISKDD 105


>AE014297-1499|AAF54797.2|  230|Drosophila melanogaster CG33098-PB,
           isoform B protein.
          Length = 230

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 399 SEAEELFSQFDTDSSGSISLDE 464
           +E +E+FS FDTD  G IS D+
Sbjct: 84  AELKEVFSLFDTDCDGLISKDD 105


>AE014296-216|AAN11468.1|  192|Drosophila melanogaster CG9148-PB,
           isoform B protein.
          Length = 192

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 312 RRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           R +D DG   LN+EE    I     + +++EA+ L  + D D    ++ +E L K
Sbjct: 118 RDLDKDG--YLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDK 170


>AE014296-215|AAS64929.1|  329|Drosophila melanogaster CG9148-PC,
           isoform C protein.
          Length = 329

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 312 RRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           R +D DG   LN+EE    I     + +++EA+ L  + D D    ++ +E L K
Sbjct: 255 RDLDKDG--YLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDK 307


>AE014296-214|AAF47468.2|  329|Drosophila melanogaster CG9148-PA,
           isoform A protein.
          Length = 329

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 312 RRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           R +D DG   LN+EE    I     + +++EA+ L  + D D    ++ +E L K
Sbjct: 255 RDLDKDG--YLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDK 307


>AB011261-1|BAA34049.1|  193|Drosophila melanogaster supercoiling
           factor protein.
          Length = 193

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 312 RRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIK 476
           R +D DG   LN+EE    I     + +++EA+ L  + D D    ++ +E L K
Sbjct: 119 RDLDKDG--YLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDK 171


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,223,558
Number of Sequences: 53049
Number of extensions: 470967
Number of successful extensions: 1603
Number of sequences better than 10.0: 97
Number of HSP's better than 10.0 without gapping: 1444
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1583
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2420893683
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).