SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0112
         (679 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT025818-1|ABF85718.1| 1416|Drosophila melanogaster IP03271p pro...    31   1.1  
BT010019-1|AAQ22488.1| 1506|Drosophila melanogaster RE10624p pro...    31   1.1  
AF053358-1|AAC35280.1| 1383|Drosophila melanogaster guanine nucl...    31   1.1  
AE014298-952|AAF46200.2| 1571|Drosophila melanogaster CG3126-PA,...    31   1.1  
AE014298-951|AAO41635.1| 1520|Drosophila melanogaster CG3126-PB,...    31   1.1  
AY075291-1|AAL68158.2| 1193|Drosophila melanogaster AT30755p pro...    30   2.5  
AE014297-3139|AAN14374.2| 1304|Drosophila melanogaster CG31169-P...    30   2.5  
AE014297-3138|AAF55983.2| 1469|Drosophila melanogaster CG31169-P...    30   2.5  
BT003220-1|AAO24975.1|  513|Drosophila melanogaster RE02054p pro...    30   3.3  
AY061284-1|AAL28832.1|  513|Drosophila melanogaster LD20239p pro...    30   3.3  
AE014296-2411|AAF49717.2| 1333|Drosophila melanogaster CG17177-P...    30   3.3  
AE013599-3047|AAF57443.3|  513|Drosophila melanogaster CG11175-P...    30   3.3  

>BT025818-1|ABF85718.1| 1416|Drosophila melanogaster IP03271p
           protein.
          Length = 1416

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 229 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 89
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 498 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 544


>BT010019-1|AAQ22488.1| 1506|Drosophila melanogaster RE10624p
           protein.
          Length = 1506

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 229 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 89
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 602 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 648


>AF053358-1|AAC35280.1| 1383|Drosophila melanogaster guanine
           nucleotide exchange factorDC3G protein.
          Length = 1383

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 229 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 89
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 464 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 510


>AE014298-952|AAF46200.2| 1571|Drosophila melanogaster CG3126-PA,
           isoform A protein.
          Length = 1571

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 229 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 89
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 602 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 648


>AE014298-951|AAO41635.1| 1520|Drosophila melanogaster CG3126-PB,
           isoform B protein.
          Length = 1520

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -1

Query: 229 SLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 89
           SL   G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 602 SLLNYGVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 648


>AY075291-1|AAL68158.2| 1193|Drosophila melanogaster AT30755p protein.
          Length = 1193

 Score = 30.3 bits (65), Expect = 2.5
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = -1

Query: 244  SKAETSLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRR 92
            SK E  +    KD+   EP ES  SK+   TS  S SK+E++R+     RR
Sbjct: 942  SKTEAVIEPVAKDVSMAEPNESLHSKK--ETSPASLSKQESKRKQKRSLRR 990


>AE014297-3139|AAN14374.2| 1304|Drosophila melanogaster CG31169-PB,
            isoform B protein.
          Length = 1304

 Score = 30.3 bits (65), Expect = 2.5
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = -1

Query: 244  SKAETSLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRR 92
            SK E  +    KD+   EP ES  SK+   TS  S SK+E++R+     RR
Sbjct: 1053 SKTEAVIEPVAKDVSMAEPNESLHSKK--ETSPASLSKQESKRKQKRSLRR 1101


>AE014297-3138|AAF55983.2| 1469|Drosophila melanogaster CG31169-PA,
            isoform A protein.
          Length = 1469

 Score = 30.3 bits (65), Expect = 2.5
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = -1

Query: 244  SKAETSLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRR 92
            SK E  +    KD+   EP ES  SK+   TS  S SK+E++R+     RR
Sbjct: 1218 SKTEAVIEPVAKDVSMAEPNESLHSKK--ETSPASLSKQESKRKQKRSLRR 1266


>BT003220-1|AAO24975.1|  513|Drosophila melanogaster RE02054p
           protein.
          Length = 513

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 25/99 (25%), Positives = 39/99 (39%), Gaps = 2/99 (2%)
 Frame = +3

Query: 21  HRTELYSDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTV 200
           HR +   DLR     +      +D  D N     ++  + +  L  SH   PP   GST 
Sbjct: 285 HRAQSLMDLRCTLPGMYNPRHVLDTEDKNAKYFNITIDDLKNNLHDSHRPSPPSLIGST- 343

Query: 201 SISLPDSARLVSALEAFRII--PRMVASHHRPLGRVHEP 311
                 +  +  ++E  ++   P    SHHRP G   +P
Sbjct: 344 -----SNDPIYCSIEPKQLTPPPAQQRSHHRPRGTHKQP 377


>AY061284-1|AAL28832.1|  513|Drosophila melanogaster LD20239p
           protein.
          Length = 513

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 25/99 (25%), Positives = 39/99 (39%), Gaps = 2/99 (2%)
 Frame = +3

Query: 21  HRTELYSDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTV 200
           HR +   DLR     +      +D  D N     ++  + +  L  SH   PP   GST 
Sbjct: 285 HRAQSLMDLRCTLPGMYNPRHVLDTEDKNAKYFNITIDDLKNNLHDSHRPSPPSLIGST- 343

Query: 201 SISLPDSARLVSALEAFRII--PRMVASHHRPLGRVHEP 311
                 +  +  ++E  ++   P    SHHRP G   +P
Sbjct: 344 -----SNDPIYCSIEPKQLTPPPAQQRSHHRPRGTHKQP 377


>AE014296-2411|AAF49717.2| 1333|Drosophila melanogaster CG17177-PA
           protein.
          Length = 1333

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +1

Query: 289 RSAECMNQMSETAVPLVLSSITIATTSHQ*G 381
           +  EC  Q+S  ++ LV+S+IT+AT +H  G
Sbjct: 701 QQCECHAQVSIASLLLVISAITVATNTHDYG 731


>AE013599-3047|AAF57443.3|  513|Drosophila melanogaster CG11175-PA
           protein.
          Length = 513

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 25/99 (25%), Positives = 39/99 (39%), Gaps = 2/99 (2%)
 Frame = +3

Query: 21  HRTELYSDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTV 200
           HR +   DLR     +      +D  D N     ++  + +  L  SH   PP   GST 
Sbjct: 285 HRAQSLMDLRCTLPGMYNPRHVLDTEDKNAKYFNITIDDLKNNLHDSHRPSPPSLIGST- 343

Query: 201 SISLPDSARLVSALEAFRII--PRMVASHHRPLGRVHEP 311
                 +  +  ++E  ++   P    SHHRP G   +P
Sbjct: 344 -----SNDPIYCSIEPKQLTPPPAQQRSHHRPRGTHKQP 377


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,618,577
Number of Sequences: 53049
Number of extensions: 620760
Number of successful extensions: 1403
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1360
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1403
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2951284050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).