SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0110
         (490 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT012669-1|AAT08475.1|   46|Drosophila melanogaster LD48059p pro...    53   2e-07
BT010292-1|AAQ23610.1|  662|Drosophila melanogaster LD16296p pro...    29   3.4  
BT001262-1|AAN71018.1|  833|Drosophila melanogaster AT02677p pro...    29   3.4  
AE014134-226|AAF51398.3|  662|Drosophila melanogaster CG4896-PB,...    29   3.4  
AE014134-225|AAF51399.3|  662|Drosophila melanogaster CG4896-PA,...    29   3.4  
AE014134-224|AAN10483.2|  949|Drosophila melanogaster CG4896-PD,...    29   3.4  
AE014134-223|AAN10482.2|  968|Drosophila melanogaster CG4896-PC,...    29   3.4  
AE014296-3256|AAF49087.1|  720|Drosophila melanogaster CG17732-P...    28   6.0  
L77907-1|AAC37264.1| 1883|Drosophila melanogaster chromodomain-h...    28   7.9  
BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p pro...    28   7.9  
AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p pro...    28   7.9  
AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA ...    28   7.9  

>BT012669-1|AAT08475.1|   46|Drosophila melanogaster LD48059p
           protein.
          Length = 46

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 23/31 (74%), Positives = 26/31 (83%)
 Frame = +3

Query: 162 EHKCWDPKDGELCLVRSQSGETLMEDRSDSD 254
           EH C DPKDGEL L+R +SGETLMEDR+ SD
Sbjct: 9   EHICCDPKDGELYLIRLKSGETLMEDRNSSD 39


>BT010292-1|AAQ23610.1|  662|Drosophila melanogaster LD16296p
           protein.
          Length = 662

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +1

Query: 163 STNAGTRKMVNYAWS-GRSQGKP-*WRTVAILTANRSSELGIGAKD*SNHLVAGS 321
           STN G+R M    WS G+  GK    RT  I    RS+ +G+G    + H+  G+
Sbjct: 593 STNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNN--TGHMAPGN 645


>BT001262-1|AAN71018.1|  833|Drosophila melanogaster AT02677p
           protein.
          Length = 833

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +1

Query: 163 STNAGTRKMVNYAWS-GRSQGKP-*WRTVAILTANRSSELGIGAKD*SNHLVAGS 321
           STN G+R M    WS G+  GK    RT  I    RS+ +G+G    + H+  G+
Sbjct: 764 STNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNN--TGHMAPGN 816


>AE014134-226|AAF51398.3|  662|Drosophila melanogaster CG4896-PB,
           isoform B protein.
          Length = 662

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +1

Query: 163 STNAGTRKMVNYAWS-GRSQGKP-*WRTVAILTANRSSELGIGAKD*SNHLVAGS 321
           STN G+R M    WS G+  GK    RT  I    RS+ +G+G    + H+  G+
Sbjct: 593 STNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNN--TGHMAPGN 645


>AE014134-225|AAF51399.3|  662|Drosophila melanogaster CG4896-PA,
           isoform A protein.
          Length = 662

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +1

Query: 163 STNAGTRKMVNYAWS-GRSQGKP-*WRTVAILTANRSSELGIGAKD*SNHLVAGS 321
           STN G+R M    WS G+  GK    RT  I    RS+ +G+G    + H+  G+
Sbjct: 593 STNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNN--TGHMAPGN 645


>AE014134-224|AAN10483.2|  949|Drosophila melanogaster CG4896-PD,
            isoform D protein.
          Length = 949

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +1

Query: 163  STNAGTRKMVNYAWS-GRSQGKP-*WRTVAILTANRSSELGIGAKD*SNHLVAGS 321
            STN G+R M    WS G+  GK    RT  I    RS+ +G+G    + H+  G+
Sbjct: 880  STNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNN--TGHMAPGN 932


>AE014134-223|AAN10482.2|  968|Drosophila melanogaster CG4896-PC,
            isoform C protein.
          Length = 968

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +1

Query: 163  STNAGTRKMVNYAWS-GRSQGKP-*WRTVAILTANRSSELGIGAKD*SNHLVAGS 321
            STN G+R M    WS G+  GK    RT  I    RS+ +G+G    + H+  G+
Sbjct: 899  STNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNN--TGHMAPGN 951


>AE014296-3256|AAF49087.1|  720|Drosophila melanogaster CG17732-PA
           protein.
          Length = 720

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = -2

Query: 246 RYGPPSGFPLTAT*PGIVHHLSGPSICAQSA 154
           R G P  F  TA    ++HH+  P++C + A
Sbjct: 303 RSGSPEDFGQTALCQQLIHHIVQPNVCNEDA 333


>L77907-1|AAC37264.1| 1883|Drosophila melanogaster
           chromodomain-helicase-DNA-bindingprotein protein.
          Length = 1883

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = -2

Query: 195 VHHLSGPSICAQSAPSFTDWKR 130
           +HHL GP +C     + T W+R
Sbjct: 573 IHHLYGPFLCVVPLSTMTAWQR 594


>BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p
           protein.
          Length = 1645

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = -2

Query: 195 VHHLSGPSICAQSAPSFTDWKR 130
           +HHL GP +C     + T W+R
Sbjct: 573 IHHLYGPFLCVVPLSTMTAWQR 594


>AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p
           protein.
          Length = 1101

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = -2

Query: 195 VHHLSGPSICAQSAPSFTDWKR 130
           +HHL GP +C     + T W+R
Sbjct: 41  IHHLYGPFLCVVPLSTMTAWQR 62


>AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA
           protein.
          Length = 1883

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = -2

Query: 195 VHHLSGPSICAQSAPSFTDWKR 130
           +HHL GP +C     + T W+R
Sbjct: 573 IHHLYGPFLCVVPLSTMTAWQR 594


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,014,019
Number of Sequences: 53049
Number of extensions: 439744
Number of successful extensions: 941
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 921
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 941
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1726192251
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).