SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0106
         (711 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT010311-1|AAQ23629.1|  511|Drosophila melanogaster AT31519p pro...    31   1.5  
AE014134-2482|AAF53383.1|  511|Drosophila melanogaster CG15286-P...    31   1.5  
AY052005-1|AAK93429.1|  689|Drosophila melanogaster LD46952p pro...    29   8.2  
AE014297-1937|AAN13624.1|  689|Drosophila melanogaster CG6904-PC...    29   8.2  
AE014297-1936|AAN13623.1|  689|Drosophila melanogaster CG6904-PB...    29   8.2  
AE014297-1935|AAF55132.2|  709|Drosophila melanogaster CG6904-PA...    29   8.2  
AE013599-3769|AAX52680.1| 4129|Drosophila melanogaster CG33519-P...    29   8.2  

>BT010311-1|AAQ23629.1|  511|Drosophila melanogaster AT31519p
           protein.
          Length = 511

 Score = 31.1 bits (67), Expect = 1.5
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = -2

Query: 236 ILSTRGSSPWRPAADMGTNRRDISTYIP 153
           ++ TR ++P +PAA++G N R I+ Y P
Sbjct: 316 VIRTRHANPAQPAANIGNNTRSINVYGP 343


>AE014134-2482|AAF53383.1|  511|Drosophila melanogaster CG15286-PA
           protein.
          Length = 511

 Score = 31.1 bits (67), Expect = 1.5
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = -2

Query: 236 ILSTRGSSPWRPAADMGTNRRDISTYIP 153
           ++ TR ++P +PAA++G N R I+ Y P
Sbjct: 316 VIRTRHANPAQPAANIGNNTRSINVYGP 343


>AY052005-1|AAK93429.1|  689|Drosophila melanogaster LD46952p
           protein.
          Length = 689

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = -1

Query: 447 FRECHIKYIQFLRPHYIKILTR*NEHNARTSTRPGTGPHPLPVQTRH 307
           +R+  +K +Q + P Y+  L+     N    +RP + P P P  +RH
Sbjct: 616 YRQARVKALQAVYPDYVDELSLYGSKNNLIFSRPHSEP-PSPTSSRH 661


>AE014297-1937|AAN13624.1|  689|Drosophila melanogaster CG6904-PC,
           isoform C protein.
          Length = 689

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = -1

Query: 447 FRECHIKYIQFLRPHYIKILTR*NEHNARTSTRPGTGPHPLPVQTRH 307
           +R+  +K +Q + P Y+  L+     N    +RP + P P P  +RH
Sbjct: 616 YRQARVKALQAVYPDYVDELSLYGSKNNLIFSRPHSEP-PSPTSSRH 661


>AE014297-1936|AAN13623.1|  689|Drosophila melanogaster CG6904-PB,
           isoform B protein.
          Length = 689

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = -1

Query: 447 FRECHIKYIQFLRPHYIKILTR*NEHNARTSTRPGTGPHPLPVQTRH 307
           +R+  +K +Q + P Y+  L+     N    +RP + P P P  +RH
Sbjct: 616 YRQARVKALQAVYPDYVDELSLYGSKNNLIFSRPHSEP-PSPTSSRH 661


>AE014297-1935|AAF55132.2|  709|Drosophila melanogaster CG6904-PA,
           isoform A protein.
          Length = 709

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = -1

Query: 447 FRECHIKYIQFLRPHYIKILTR*NEHNARTSTRPGTGPHPLPVQTRH 307
           +R+  +K +Q + P Y+  L+     N    +RP + P P P  +RH
Sbjct: 636 YRQARVKALQAVYPDYVDELSLYGSKNNLIFSRPHSEP-PSPTSSRH 681


>AE013599-3769|AAX52680.1| 4129|Drosophila melanogaster CG33519-PB
           protein.
          Length = 4129

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 13/34 (38%), Positives = 17/34 (50%)
 Frame = -2

Query: 377 TNITHEHRPDPAPVRIRFPSKPDTPRSSEPILIP 276
           T+   E  P P P  +  P+K  TP  SEP+  P
Sbjct: 452 TSPVKEVAPPPQPRAVASPAKEVTPSQSEPVKAP 485


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,144,763
Number of Sequences: 53049
Number of extensions: 866317
Number of successful extensions: 3510
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 3000
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3510
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3149551053
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).