SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0105
         (697 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014296-2411|AAF49717.2| 1333|Drosophila melanogaster CG17177-P...    30   3.5  
BT025818-1|ABF85718.1| 1416|Drosophila melanogaster IP03271p pro...    29   4.6  
BT010019-1|AAQ22488.1| 1506|Drosophila melanogaster RE10624p pro...    29   4.6  
AF053358-1|AAC35280.1| 1383|Drosophila melanogaster guanine nucl...    29   4.6  
AE014298-952|AAF46200.2| 1571|Drosophila melanogaster CG3126-PA,...    29   4.6  
AE014298-951|AAO41635.1| 1520|Drosophila melanogaster CG3126-PB,...    29   4.6  
AY061151-1|AAL28699.1|  948|Drosophila melanogaster LD12377p pro...    29   8.0  
AE014297-3194|AAX52971.1|  993|Drosophila melanogaster CG31156-P...    29   8.0  
AE014297-3193|AAF56028.3|  948|Drosophila melanogaster CG31156-P...    29   8.0  

>AE014296-2411|AAF49717.2| 1333|Drosophila melanogaster CG17177-PA
           protein.
          Length = 1333

 Score = 29.9 bits (64), Expect = 3.5
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = -1

Query: 439 RSAECMNQMSETAVPLVLSSITIATTSHQ*G 347
           +  EC  Q+S  ++ LV+S+IT+AT +H  G
Sbjct: 701 QQCECHAQVSIASLLLVISAITVATNTHDYG 731


>BT025818-1|ABF85718.1| 1416|Drosophila melanogaster IP03271p
           protein.
          Length = 1416

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +3

Query: 513 GKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 638
           G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 503 GVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 544


>BT010019-1|AAQ22488.1| 1506|Drosophila melanogaster RE10624p
           protein.
          Length = 1506

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +3

Query: 513 GKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 638
           G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 607 GVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 648


>AF053358-1|AAC35280.1| 1383|Drosophila melanogaster guanine
           nucleotide exchange factorDC3G protein.
          Length = 1383

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +3

Query: 513 GKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 638
           G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 469 GVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 510


>AE014298-952|AAF46200.2| 1571|Drosophila melanogaster CG3126-PA,
           isoform A protein.
          Length = 1571

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +3

Query: 513 GKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 638
           G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 607 GVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 648


>AE014298-951|AAO41635.1| 1520|Drosophila melanogaster CG3126-PB,
           isoform B protein.
          Length = 1520

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +3

Query: 513 GKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 638
           G D L+V  R    + QC F S ++HS+ E  ++      RS
Sbjct: 607 GVDRLSVRSRSPDENSQCSFDSALNHSREEEDQQQQHQHLRS 648


>AY061151-1|AAL28699.1|  948|Drosophila melanogaster LD12377p
           protein.
          Length = 948

 Score = 28.7 bits (61), Expect = 8.0
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +1

Query: 241 SALPILRTNIRQALDCSPIKRERELGLD 324
           +A+ +   N++Q L  SP+K ER LG+D
Sbjct: 505 AAIDVFAKNLKQLLLISPLKGERILGID 532


>AE014297-3194|AAX52971.1|  993|Drosophila melanogaster CG31156-PB,
           isoform B protein.
          Length = 993

 Score = 28.7 bits (61), Expect = 8.0
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +1

Query: 241 SALPILRTNIRQALDCSPIKRERELGLD 324
           +A+ +   N++Q L  SP+K ER LG+D
Sbjct: 505 AAIDVFAKNLKQLLLISPLKGERILGID 532


>AE014297-3193|AAF56028.3|  948|Drosophila melanogaster CG31156-PA,
           isoform A protein.
          Length = 948

 Score = 28.7 bits (61), Expect = 8.0
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +1

Query: 241 SALPILRTNIRQALDCSPIKRERELGLD 324
           +A+ +   N++Q L  SP+K ER LG+D
Sbjct: 505 AAIDVFAKNLKQLLLISPLKGERILGID 532


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,027,840
Number of Sequences: 53049
Number of extensions: 675457
Number of successful extensions: 1731
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1666
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1731
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3046624548
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).