SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0103
         (685 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT016165-1|AAV37050.1|  736|Drosophila melanogaster AT07541p pro...    29   7.8  
AL121804-5|CAB65857.1|  729|Drosophila melanogaster EG:BACR7C10....    29   7.8  
AE014298-424|AAF45799.2|  750|Drosophila melanogaster CG13762-PA...    29   7.8  

>BT016165-1|AAV37050.1|  736|Drosophila melanogaster AT07541p
           protein.
          Length = 736

 Score = 28.7 bits (61), Expect = 7.8
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 1/99 (1%)
 Frame = +1

Query: 28  WTGSGCGRCRVWSMFVRYVR-FSELVF*YNAASKTVYI*YDTRENRLTFRTGSGPAFSGL 204
           W G  C     + + V  +  F  L+  Y   +KT+      RENR+TF       FSG+
Sbjct: 582 WLGILCYGVLAFVIIVLLINVFVSLINDYFTVAKTIRD--SERENRITFFEFLVVEFSGV 639

Query: 205 PRIFLAVRSCRFRFVRDGTILYDRRSTVSSELARTRGIR 321
              F  +   R  +VR+G  + +  S     + R R +R
Sbjct: 640 LGRFRKLPCWRRNYVRNGRTVAENVSRKLDSMDRQRLMR 678


>AL121804-5|CAB65857.1|  729|Drosophila melanogaster EG:BACR7C10.7
           protein.
          Length = 729

 Score = 28.7 bits (61), Expect = 7.8
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 1/99 (1%)
 Frame = +1

Query: 28  WTGSGCGRCRVWSMFVRYVR-FSELVF*YNAASKTVYI*YDTRENRLTFRTGSGPAFSGL 204
           W G  C     + + V  +  F  L+  Y   +KT+      RENR+TF       FSG+
Sbjct: 544 WLGILCYGVLAFVIIVLLINVFVSLINDYFTVAKTIRD--SERENRITFFEFLVVEFSGV 601

Query: 205 PRIFLAVRSCRFRFVRDGTILYDRRSTVSSELARTRGIR 321
              F  +   R  +VR+G  + +  S     + R R +R
Sbjct: 602 LGRFRKLPCWRRNYVRNGRTVAENVSRKLDSMDRQRLMR 640


>AE014298-424|AAF45799.2|  750|Drosophila melanogaster CG13762-PA
           protein.
          Length = 750

 Score = 28.7 bits (61), Expect = 7.8
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 1/99 (1%)
 Frame = +1

Query: 28  WTGSGCGRCRVWSMFVRYVR-FSELVF*YNAASKTVYI*YDTRENRLTFRTGSGPAFSGL 204
           W G  C     + + V  +  F  L+  Y   +KT+      RENR+TF       FSG+
Sbjct: 565 WLGILCYGVLAFVIIVLLINVFVSLINDYFTVAKTIRD--SERENRITFFEFLVVEFSGV 622

Query: 205 PRIFLAVRSCRFRFVRDGTILYDRRSTVSSELARTRGIR 321
              F  +   R  +VR+G  + +  S     + R R +R
Sbjct: 623 LGRFRKLPCWRRNYVRNGRTVAENVSRKLDSMDRQRLMR 661


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,305,602
Number of Sequences: 53049
Number of extensions: 631732
Number of successful extensions: 1595
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1517
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1595
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2992560750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).