SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0101
         (509 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U01119-1|AAC04309.1|  308|Drosophila melanogaster GTP cyclohydro...    30   2.1  
AF159422-1|AAD44334.1|  324|Drosophila melanogaster GTP cyclohyd...    30   2.1  
AY058593-1|AAL13822.1|  767|Drosophila melanogaster LD28817p pro...    28   6.4  
AE014297-1398|AAF54712.1|  767|Drosophila melanogaster CG6962-PA...    28   6.4  
AE014298-1804|AAF48196.2| 3604|Drosophila melanogaster CG4013-PC...    28   8.4  
AE014298-1803|AAN09315.1| 3604|Drosophila melanogaster CG4013-PB...    28   8.4  
AE014298-1802|AAF48195.2| 3604|Drosophila melanogaster CG4013-PA...    28   8.4  

>U01119-1|AAC04309.1|  308|Drosophila melanogaster GTP
           cyclohydrolase I protein.
          Length = 308

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 19/43 (44%), Positives = 22/43 (51%)
 Frame = -1

Query: 482 APVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERHTVRPPI 354
           AP   P W   RTGSR   +RRR  P R H +R  RH    P+
Sbjct: 43  APRAPPRW---RTGSRT--RRRRPLPLRAHPSRRWRHPALVPL 80


>AF159422-1|AAD44334.1|  324|Drosophila melanogaster GTP
           cyclohydrolase I isoform c protein.
          Length = 324

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 19/43 (44%), Positives = 22/43 (51%)
 Frame = -1

Query: 482 APVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERHTVRPPI 354
           AP   P W   RTGSR   +RRR  P R H +R  RH    P+
Sbjct: 43  APRAPPRW---RTGSRT--RRRRPLPLRAHPSRRWRHPALVPL 80


>AY058593-1|AAL13822.1|  767|Drosophila melanogaster LD28817p
           protein.
          Length = 767

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = -1

Query: 137 RDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTF 3
           R  G L N + ++    T+   TLRE   +P   R C++ F  TF
Sbjct: 536 RSEGFLKNFYKKIFGECTQEEVTLREFSRIPEVLRQCIDAFCRTF 580


>AE014297-1398|AAF54712.1|  767|Drosophila melanogaster CG6962-PA
           protein.
          Length = 767

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = -1

Query: 137 RDSGNLVNPFMRVTN*MTRHLATLRES*LLPPFTRACLNFFTLTF 3
           R  G L N + ++    T+   TLRE   +P   R C++ F  TF
Sbjct: 536 RSEGFLKNFYKKIFGECTQEEVTLREFSRIPEVLRQCIDAFCRTF 580


>AE014298-1804|AAF48196.2| 3604|Drosophila melanogaster CG4013-PC,
           isoform C protein.
          Length = 3604

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 21/93 (22%), Positives = 47/93 (50%)
 Frame = -3

Query: 474 QTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVV 295
           QT R + ++N I+    +++++ +++ L    T++    +  + +    N  S+ +   +
Sbjct: 54  QTVRNSSNNNTIS----SSSNIISSNVLLPAATSNSNNNNYSNSSSSSSNNSSSSSSSSM 109

Query: 294 VFQRRSREXISHLSTPLMSPYNARLESSSTGSA 196
           +  +R    I+HLS  L+S    R  SSS+ S+
Sbjct: 110 IMDQRPIICINHLSASLISRIKRRNSSSSSSSS 142


>AE014298-1803|AAN09315.1| 3604|Drosophila melanogaster CG4013-PB,
           isoform B protein.
          Length = 3604

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 21/93 (22%), Positives = 47/93 (50%)
 Frame = -3

Query: 474 QTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVV 295
           QT R + ++N I+    +++++ +++ L    T++    +  + +    N  S+ +   +
Sbjct: 54  QTVRNSSNNNTIS----SSSNIISSNVLLPAATSNSNNNNYSNSSSSSSNNSSSSSSSSM 109

Query: 294 VFQRRSREXISHLSTPLMSPYNARLESSSTGSA 196
           +  +R    I+HLS  L+S    R  SSS+ S+
Sbjct: 110 IMDQRPIICINHLSASLISRIKRRNSSSSSSSS 142


>AE014298-1802|AAF48195.2| 3604|Drosophila melanogaster CG4013-PA,
           isoform A protein.
          Length = 3604

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 21/93 (22%), Positives = 47/93 (50%)
 Frame = -3

Query: 474 QTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVV 295
           QT R + ++N I+    +++++ +++ L    T++    +  + +    N  S+ +   +
Sbjct: 54  QTVRNSSNNNTIS----SSSNIISSNVLLPAATSNSNNNNYSNSSSSSSNNSSSSSSSSM 109

Query: 294 VFQRRSREXISHLSTPLMSPYNARLESSSTGSA 196
           +  +R    I+HLS  L+S    R  SSS+ S+
Sbjct: 110 IMDQRPIICINHLSASLISRIKRRNSSSSSSSS 142


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,328,197
Number of Sequences: 53049
Number of extensions: 525962
Number of successful extensions: 1726
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1633
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1723
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1846255872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).