SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY069812-1|AAL39957.1|  937|Drosophila melanogaster SD05477p pro...    29   5.4  
AY061451-1|AAL28999.1|  249|Drosophila melanogaster LD38807p pro...    29   5.4  
AE014298-1945|AAN09334.1|  937|Drosophila melanogaster CG32627-P...    29   5.4  
AE014298-1944|AAF48304.2| 1201|Drosophila melanogaster CG32627-P...    29   5.4  
AE014297-2568|AAF55584.1|  950|Drosophila melanogaster CG7709-PA...    28   9.4  

>AY069812-1|AAL39957.1|  937|Drosophila melanogaster SD05477p
           protein.
          Length = 937

 Score = 29.1 bits (62), Expect = 5.4
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = -2

Query: 496 FAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGV 317
           FA+P   ++ D +   P  P E  V+ E  + H+ Y +  VP   N+P G+ L+P   G 
Sbjct: 181 FALPKDKDN-DCSQQAPRWPVECQVIEERII-HIPY-VPAVPEPLNAPTGNELKPRPVGE 237

Query: 316 LNG 308
            NG
Sbjct: 238 ENG 240


>AY061451-1|AAL28999.1|  249|Drosophila melanogaster LD38807p
           protein.
          Length = 249

 Score = 29.1 bits (62), Expect = 5.4
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%)
 Frame = -2

Query: 169 SRETISHLCYTSHVSL---QCQTRVKLNRVFFPR*FSQARSLGC 47
           S+ TI   CY  ++S    QCQ R+   +VFF    S A    C
Sbjct: 14  SKRTIFETCYMKNISFLKTQCQARILFCKVFFAVHSSNANVPSC 57


>AE014298-1945|AAN09334.1|  937|Drosophila melanogaster CG32627-PB,
           isoform B protein.
          Length = 937

 Score = 29.1 bits (62), Expect = 5.4
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = -2

Query: 496 FAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGV 317
           FA+P   ++ D +   P  P E  V+ E  + H+ Y +  VP   N+P G+ L+P   G 
Sbjct: 181 FALPKDKDN-DCSQQAPRWPVECQVIEERII-HIPY-VPAVPEPLNAPTGNELKPRPVGE 237

Query: 316 LNG 308
            NG
Sbjct: 238 ENG 240


>AE014298-1944|AAF48304.2| 1201|Drosophila melanogaster CG32627-PA,
           isoform A protein.
          Length = 1201

 Score = 29.1 bits (62), Expect = 5.4
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = -2

Query: 496 FAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGV 317
           FA+P   ++ D +   P  P E  V+ E  + H+ Y +  VP   N+P G+ L+P   G 
Sbjct: 181 FALPKDKDN-DCSQQAPRWPVECQVIEERII-HIPY-VPAVPEPLNAPTGNELKPRPVGE 237

Query: 316 LNG 308
            NG
Sbjct: 238 ENG 240


>AE014297-2568|AAF55584.1|  950|Drosophila melanogaster CG7709-PA
           protein.
          Length = 950

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = -3

Query: 156 SPTYATPLMSPYNARLESSSTGSSFPADSPKP 61
           +P++ +   S Y A  +S+S+G  +PA +P+P
Sbjct: 153 APSFNSAPSSSYAAPSQSASSGGPYPAAAPRP 184


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,408,504
Number of Sequences: 53049
Number of extensions: 679421
Number of successful extensions: 2404
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 2304
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2404
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2724262200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).