SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0099
         (684 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U77947-1|AAB41404.1| 2416|Drosophila melanogaster adenomatous po...    32   0.64 
AE014297-4275|AAF56820.1| 2417|Drosophila melanogaster CG1451-PA...    32   0.64 
AE014297-2568|AAF55584.1|  950|Drosophila melanogaster CG7709-PA...    29   4.5  
U04809-1|AAA19430.1|  622|Drosophila melanogaster cocaine-sensit...    29   5.9  
AY071023-1|AAL48645.1|  622|Drosophila melanogaster RE10485p pro...    29   5.9  
AE013599-3863|AAF47200.1|  622|Drosophila melanogaster CG4545-PA...    29   5.9  

>U77947-1|AAB41404.1| 2416|Drosophila melanogaster adenomatous
            polyposis coli protein.
          Length = 2416

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = -1

Query: 354  APADIIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPA 175
            APA +  +     +  +N  ++V V + +  +T+PT+     S    +  ++S GS   A
Sbjct: 2220 APARLERQGTFVKDEPTNSNVQVPVVETKPAQTSPTHRA---SKLPTKKGTASGGSPSKA 2276

Query: 174  DSPKPVPLA 148
             SPK +PLA
Sbjct: 2277 GSPKRIPLA 2285


>AE014297-4275|AAF56820.1| 2417|Drosophila melanogaster CG1451-PA
            protein.
          Length = 2417

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = -1

Query: 354  APADIIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPA 175
            APA +  +     +  +N  ++V V + +  +T+PT+     S    +  ++S GS   A
Sbjct: 2221 APARLERQGTFVKDEPTNSNVQVPVVETKPAQTSPTHRA---SKLPTKKGTASGGSPSKA 2277

Query: 174  DSPKPVPLA 148
             SPK +PLA
Sbjct: 2278 GSPKRIPLA 2286


>AE014297-2568|AAF55584.1|  950|Drosophila melanogaster CG7709-PA
           protein.
          Length = 950

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 27/104 (25%), Positives = 47/104 (45%), Gaps = 2/104 (1%)
 Frame = -1

Query: 465 SQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNE--TM 292
           S +P  A S  R+      A +V A S +  +G +   P +     P  P R S++    
Sbjct: 83  SSSPGEAASVMRVQLFGVIAVAVVAVSLVRDVGAE--PPVNNAYLPPSSPQRPSSKYGAP 140

Query: 291 KVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKP 160
            V  +   +    P++ +   S Y A  +S+S+G  +PA +P+P
Sbjct: 141 PVSSYLPPASGPAPSFNSAPSSSYAAPSQSASSGGPYPAAAPRP 184


>U04809-1|AAA19430.1|  622|Drosophila melanogaster cocaine-sensitive
           serotonin transporterprotein.
          Length = 622

 Score = 29.1 bits (62), Expect = 5.9
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -1

Query: 360 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 256
           H  PA + D  PL P   +NE + VV    R+RET
Sbjct: 44  HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76


>AY071023-1|AAL48645.1|  622|Drosophila melanogaster RE10485p
           protein.
          Length = 622

 Score = 29.1 bits (62), Expect = 5.9
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -1

Query: 360 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 256
           H  PA + D  PL P   +NE + VV    R+RET
Sbjct: 44  HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76


>AE013599-3863|AAF47200.1|  622|Drosophila melanogaster CG4545-PA
           protein.
          Length = 622

 Score = 29.1 bits (62), Expect = 5.9
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -1

Query: 360 HRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRET 256
           H  PA + D  PL P   +NE + VV    R+RET
Sbjct: 44  HTTPAKVTD--PLAPKLANNERILVVSVTERTRET 76


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,384,713
Number of Sequences: 53049
Number of extensions: 730449
Number of successful extensions: 2514
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 2358
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2512
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2992560750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).