SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0097
         (620 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT001681-1|AAN71436.1|  168|Drosophila melanogaster RE56164p pro...    48   8e-06
AE014297-4657|AAF57081.1|  159|Drosophila melanogaster CG11314-P...    48   8e-06
AY075563-1|AAL68370.1|  134|Drosophila melanogaster RH68460p pro...    45   1e-04
AY071674-1|AAL49296.1|  157|Drosophila melanogaster RH04252p pro...    45   1e-04
AE014297-4659|AAF57082.1|  157|Drosophila melanogaster CG11315-P...    45   1e-04
AE014297-4658|AAN14257.1|  130|Drosophila melanogaster CG11315-P...    45   1e-04

>BT001681-1|AAN71436.1|  168|Drosophila melanogaster RE56164p
           protein.
          Length = 168

 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 3/63 (4%)
 Frame = +3

Query: 87  VVTTRLCREVDASACTVNEVRIDPC---VNSRLCHLKKGKNAKVSFDFTPQFSTTKLKTA 257
           VV    C +     CT+ +VR+ PC   +N+  C++++  N+++SFDFTP F    L  A
Sbjct: 34  VVNFEPCPD-SVDTCTIQQVRVSPCPEALNNAACNIRRKHNSEMSFDFTPNFDADTL-VA 91

Query: 258 SLG 266
           SLG
Sbjct: 92  SLG 94



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 17/62 (27%), Positives = 29/62 (46%)
 Frame = +1

Query: 298 SLQCDACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVR 477
           +L   AC  T CP  +G  QT    + I  K P   +  +W L  +    + CC+  +++
Sbjct: 107 TLDSAACKYTPCPVRSGVKQTYTTLVPIEAKFPLSPYTIRWAL-KDPVSQKRCCFTIDIK 165

Query: 478 LV 483
           +V
Sbjct: 166 VV 167


>AE014297-4657|AAF57081.1|  159|Drosophila melanogaster CG11314-PA
           protein.
          Length = 159

 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 3/63 (4%)
 Frame = +3

Query: 87  VVTTRLCREVDASACTVNEVRIDPC---VNSRLCHLKKGKNAKVSFDFTPQFSTTKLKTA 257
           VV    C +     CT+ +VR+ PC   +N+  C++++  N+++SFDFTP F    L  A
Sbjct: 25  VVNFEPCPD-SVDTCTIQQVRVSPCPEALNNAACNIRRKHNSEMSFDFTPNFDADTL-VA 82

Query: 258 SLG 266
           SLG
Sbjct: 83  SLG 85



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 17/62 (27%), Positives = 29/62 (46%)
 Frame = +1

Query: 298 SLQCDACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVR 477
           +L   AC  T CP  +G  QT    + I  K P   +  +W L  +    + CC+  +++
Sbjct: 98  TLDSAACKYTPCPVRSGVKQTYTTLVPIEAKFPLSPYTIRWAL-KDPVSQKRCCFTIDIK 156

Query: 478 LV 483
           +V
Sbjct: 157 VV 158


>AY075563-1|AAL68370.1|  134|Drosophila melanogaster RH68460p
           protein.
          Length = 134

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 87  VVTTRLCREVDASACTVNEVRIDPCVNSRL---CHLKKGKNAKVSFDFTPQFSTTKLKTA 257
           +V  + C +    +C++++VR+ PC  +     CH+++     +SFDFTP F    L  A
Sbjct: 23  IVNFQTCED-SVDSCSISQVRVTPCPEANANAACHIRRRHRFTMSFDFTPHFDADTL-VA 80

Query: 258 SLG*RMALKFLLMLSTM 308
           SLG   +    L L TM
Sbjct: 81  SLGWAKSENVELPLLTM 97


>AY071674-1|AAL49296.1|  157|Drosophila melanogaster RH04252p
           protein.
          Length = 157

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 87  VVTTRLCREVDASACTVNEVRIDPCVNSRL---CHLKKGKNAKVSFDFTPQFSTTKLKTA 257
           +V  + C +    +C++++VR+ PC  +     CH+++     +SFDFTP F    L  A
Sbjct: 23  IVNFQTCED-SVDSCSISQVRVTPCPEANANAACHIRRRHRFTMSFDFTPHFDADTL-VA 80

Query: 258 SLG*RMALKFLLMLSTM 308
           SLG   +    L L TM
Sbjct: 81  SLGWAKSENVELPLLTM 97



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = +1

Query: 310 DACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVRLV 483
           +AC  T+CP  +G TQT   ++    + P   +  +W L  +    + CC+  ++++V
Sbjct: 100 EACKYTTCPVRSGVTQTYTNNMPADARFPLSPYTIRWAL-KDPVSQKRCCFTIDIKVV 156


>AE014297-4659|AAF57082.1|  157|Drosophila melanogaster CG11315-PA,
           isoform A protein.
          Length = 157

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 87  VVTTRLCREVDASACTVNEVRIDPCVNSRL---CHLKKGKNAKVSFDFTPQFSTTKLKTA 257
           +V  + C +    +C++++VR+ PC  +     CH+++     +SFDFTP F    L  A
Sbjct: 23  IVNFQTCED-SVDSCSISQVRVTPCPEANANAACHIRRRHRFTMSFDFTPHFDADTL-VA 80

Query: 258 SLG*RMALKFLLMLSTM 308
           SLG   +    L L TM
Sbjct: 81  SLGWAKSENVELPLLTM 97



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = +1

Query: 310 DACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVRLV 483
           +AC  T+CP  +G TQT   ++    + P   +  +W L  +    + CC+  ++++V
Sbjct: 100 EACKYTTCPVRSGVTQTYTNNMPADARFPLSPYTIRWAL-KDPVSQKRCCFTIDIKVV 156


>AE014297-4658|AAN14257.1|  130|Drosophila melanogaster CG11315-PB,
           isoform B protein.
          Length = 130

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 87  VVTTRLCREVDASACTVNEVRIDPCVNSRL---CHLKKGKNAKVSFDFTPQFSTTKLKTA 257
           +V  + C +    +C++++VR+ PC  +     CH+++     +SFDFTP F    L  A
Sbjct: 23  IVNFQTCED-SVDSCSISQVRVTPCPEANANAACHIRRRHRFTMSFDFTPHFDADTL-VA 80

Query: 258 SLG*RMALKFLLMLSTM 308
           SLG   +    L L TM
Sbjct: 81  SLGWAKSENVELPLLTM 97


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,434,199
Number of Sequences: 53049
Number of extensions: 584652
Number of successful extensions: 1774
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1666
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1767
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2559155400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).